Recombinant Human IL-17/IL-17A Protein

Images

 

Product Details

Summary
Product Discontinued
View other related IL-17/IL-17A Peptides and Proteins

Order Details


    • Catalog Number
      P4799
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human IL-17/IL-17A Protein Summary

Description
IL-17/IL-17A (Human) Recombinant Protein

Source: E. coli

Amino Acid Sequence: IL17A: MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
IL17F: MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQ
Preparation
Method
Escherichia coli expression system
Details of Functionality
The activity is determined by the dose-dependent production of IL-6 from cultured mouse NIH 3T3 fibroblasts. The expected ED50 for this effect is 2.6-3.8 ng/mL.
Protein/Peptide Type
Recombinant Protein
Gene
IL17A

Applications/Dilutions

Application Notes
This product is useful for SDS-PAGE,Func.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
No additive.
Preservative
No Preservative
Concentration
LYOPH
Reconstitution Instructions
Reconstitute with sterilized water.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL-17/IL-17A Protein

  • CTLA-8
  • CTLA8cytotoxic T-lymphocyte-associated serine esterase 8
  • Cytotoxic T-lymphocyte-associated antigen 8
  • IL17
  • IL-17
  • IL17A
  • IL-17A
  • IL-17Acytotoxic T-lymphocyte-associated protein 8
  • IL-17CTLA-8
  • IL17interleukin-17A
  • interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
  • interleukin 17A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
594-ML/CF
Species: Mu
NBP2-25258
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
P4799
Species: Hu
Applications: Func, PAGE

Publications for IL-17/IL-17A Recombinant Protein (P4799) (0)

There are no publications for IL-17/IL-17A Recombinant Protein (P4799).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17/IL-17A Recombinant Protein (P4799) (0)

There are no reviews for IL-17/IL-17A Recombinant Protein (P4799). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for IL-17/IL-17A Recombinant Protein (P4799). (Showing 1 - 2 of 2 FAQ).

  1. I want to stain some T cell subsets (Th17 and Th1), do you have antibodies for that? I need for flow cytometer in sheep or goat.
    • Unfortunately, we have neither a CD4 antibody nor an IL-17 antibody that has been validated in sheep or goat, although if you would like to try one you would again be eligible for our Innovators Reward Program. Please contact us at innovators@novusbio.com with any questions regarding this program.
  2. I'm looking to establish an ELISA for IL-17 and want your recommendation on which antibody pairs to buy. Least expensive ones, please. Also, I'd like the detection antibody to be fluorescently labeled.
    • Thank you for your patience while I reviewed our ELISA validated products for IL17. I was not sure what species you were going to be investigating, so I looked up our data for the human protein. If this is incorrect, just let me know and I can look up products for the species you will be working with. As for antibody pairs, we only had one set that have been tested together: Capture: NBP2-22531 Detection: NBP2-22532. The detection product is only available currently with a biotin conjugate. We can however offer custom conjugation for this product to any of our available conjugates. Please see the following link to see the available fluors: http://www.novusbio.com/support/custom-antibody-labeling.html The typical fee for custom conjugation is usually about $80 additional. Once you know which fluor you would like, I can provide you with a quote. We do also offer several ELISA kits for this target (they typically employ HRP or Biotin detection systems, so I am not sure if they will work for your needs).

Additional IL-17/IL-17A Products

Bioinformatics Tool for IL-17/IL-17A Recombinant Protein (P4799)

Discover related pathways, diseases and genes to IL-17/IL-17A Recombinant Protein (P4799). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17/IL-17A Recombinant Protein (P4799)

Discover more about diseases related to IL-17/IL-17A Recombinant Protein (P4799).
 

Pathways for IL-17/IL-17A Recombinant Protein (P4799)

View related products by pathway.

PTMs for IL-17/IL-17A Recombinant Protein (P4799)

Learn more about PTMs related to IL-17/IL-17A Recombinant Protein (P4799).
 

Research Areas for IL-17/IL-17A Recombinant Protein (P4799)

Find related products by research area.

Blogs on IL-17/IL-17A

There are no specific blogs for IL-17/IL-17A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IL-17/IL-17A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17A
Entrez