IL-17/IL-17A Antibody

Immunohistochemistry-Paraffin: IL-17/IL-17A Antibody [NBP2-14121] - Staining of human small intestine shows distinct positivity in peripheral leukocytes.
Immunohistochemistry-Paraffin: IL-17/IL-17A Antibody [NBP2-14121] - Staining of human pancreas shows strong cytoplasmic positivity in granular pattern in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

IL-17/IL-17A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRN EDPERYPSVIWEAKCRHLGCIN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
40% glycerol and PBS pH 7.2.
0.02% Sodium Azide
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified

Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
IL-17/IL-17A Protein (NBP2-14121PEP)

Alternate Names for IL-17/IL-17A Antibody

  • CTLA-8
  • CTLA8cytotoxic T-lymphocyte-associated serine esterase 8
  • Cytotoxic T-lymphocyte-associated antigen 8
  • IL17
  • IL17A
  • IL-17Acytotoxic T-lymphocyte-associated protein 8
  • IL-17CTLA-8
  • IL17interleukin-17A
  • interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
  • interleukin 17A

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICFlow
Species: Hu, Mu
Applications: Flow, IHC, ICC
Species: Mu
Applications: Flow
Species: Hu, Mu
Applications: ELISA(Cap), ELISA(Cap), ELISA(Det), ELISA(Det), Neut, ELISA(Sta), ELISA(Sta)
Species: Hu
Applications: WB, Flow, Neut
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, InhibTFunc
Species: Hu
Applications: IHC, IHC-P

Publications for IL-17/IL-17A Antibody (NBP2-14121) (0)

There are no publications for IL-17/IL-17A Antibody (NBP2-14121).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17/IL-17A Antibody (NBP2-14121) (0)

There are no reviews for IL-17/IL-17A Antibody (NBP2-14121). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-17/IL-17A Antibody (NBP2-14121). (Showing 1 - 2 of 2 FAQ).

  1. I want to stain some T cell subsets (Th17 and Th1), do you have antibodies for that? I need for flow cytometer in sheep or goat.
    • Unfortunately, we have neither a CD4 antibody nor an IL-17 antibody that has been validated in sheep or goat, although if you would like to try one you would again be eligible for our Innovators Reward Program. Please contact us at with any questions regarding this program.
  2. I'm looking to establish an ELISA for IL-17 and want your recommendation on which antibody pairs to buy. Least expensive ones, please. Also, I'd like the detection antibody to be fluorescently labeled.
    • Thank you for your patience while I reviewed our ELISA validated products for IL17. I was not sure what species you were going to be investigating, so I looked up our data for the human protein. If this is incorrect, just let me know and I can look up products for the species you will be working with. As for antibody pairs, we only had one set that have been tested together: Capture: NBP2-22531 Detection: NBP2-22532. The detection product is only available currently with a biotin conjugate. We can however offer custom conjugation for this product to any of our available conjugates. Please see the following link to see the available fluors: The typical fee for custom conjugation is usually about $80 additional. Once you know which fluor you would like, I can provide you with a quote. We do also offer several ELISA kits for this target (they typically employ HRP or Biotin detection systems, so I am not sure if they will work for your needs).

Secondary Antibodies

Isotype Controls

Additional IL-17/IL-17A Antibody Products

Related Products by Gene

Bioinformatics Tool for IL-17/IL-17A Antibody (NBP2-14121)

Discover related pathways, diseases and genes to IL-17/IL-17A Antibody (NBP2-14121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17/IL-17A Antibody (NBP2-14121)

Discover more about diseases related to IL-17/IL-17A Antibody (NBP2-14121).

Pathways for IL-17/IL-17A Antibody (NBP2-14121)

View related products by pathway.

PTMs for IL-17/IL-17A Antibody (NBP2-14121)

Learn more about PTMs related to IL-17/IL-17A Antibody (NBP2-14121).

Research Areas for IL-17/IL-17A Antibody (NBP2-14121)

Find related products by research area.

Blogs on IL-17/IL-17A

There are no specific blogs for IL-17/IL-17A, but you can read our latest blog posts.

Contact Information

Product PDFs

Gene Symbol IL17A

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-14121 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought