IL-17/IL-17A Antibody


Immunohistochemistry-Paraffin: IL-17/IL-17A Antibody [NBP2-14121] - Staining of human small intestine shows distinct positivity in peripheral leukocytes.

Product Details

Product Discontinued
View other related IL-17/IL-17A Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-17/IL-17A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRN EDPERYPSVIWEAKCRHLGCIN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IL-17/IL-17A Antibody

  • CTLA-8
  • CTLA8cytotoxic T-lymphocyte-associated serine esterase 8
  • Cytotoxic T-lymphocyte-associated antigen 8
  • IL17
  • IL-17
  • IL17A
  • IL-17A
  • IL-17Acytotoxic T-lymphocyte-associated protein 8
  • IL-17CTLA-8
  • IL17interleukin-17A
  • interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
  • interleukin 17A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: IHC, IHC-P

Publications for IL-17/IL-17A Antibody (NBP2-14121) (0)

There are no publications for IL-17/IL-17A Antibody (NBP2-14121).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17/IL-17A Antibody (NBP2-14121) (0)

There are no reviews for IL-17/IL-17A Antibody (NBP2-14121). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-17/IL-17A Antibody (NBP2-14121). (Showing 1 - 2 of 2 FAQ).

  1. I want to stain some T cell subsets (Th17 and Th1), do you have antibodies for that? I need for flow cytometer in sheep or goat.
    • Unfortunately, we have neither a CD4 antibody nor an IL-17 antibody that has been validated in sheep or goat, although if you would like to try one you would again be eligible for our Innovators Reward Program. Please contact us at with any questions regarding this program.
  2. I'm looking to establish an ELISA for IL-17 and want your recommendation on which antibody pairs to buy. Least expensive ones, please. Also, I'd like the detection antibody to be fluorescently labeled.
    • Thank you for your patience while I reviewed our ELISA validated products for IL17. I was not sure what species you were going to be investigating, so I looked up our data for the human protein. If this is incorrect, just let me know and I can look up products for the species you will be working with. As for antibody pairs, we only had one set that have been tested together: Capture: NBP2-22531 Detection: NBP2-22532. The detection product is only available currently with a biotin conjugate. We can however offer custom conjugation for this product to any of our available conjugates. Please see the following link to see the available fluors: The typical fee for custom conjugation is usually about $80 additional. Once you know which fluor you would like, I can provide you with a quote. We do also offer several ELISA kits for this target (they typically employ HRP or Biotin detection systems, so I am not sure if they will work for your needs).

Secondary Antibodies


Isotype Controls

Additional IL-17/IL-17A Products

Bioinformatics Tool for IL-17/IL-17A Antibody (NBP2-14121)

Discover related pathways, diseases and genes to IL-17/IL-17A Antibody (NBP2-14121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17/IL-17A Antibody (NBP2-14121)

Discover more about diseases related to IL-17/IL-17A Antibody (NBP2-14121).

Pathways for IL-17/IL-17A Antibody (NBP2-14121)

View related products by pathway.

PTMs for IL-17/IL-17A Antibody (NBP2-14121)

Learn more about PTMs related to IL-17/IL-17A Antibody (NBP2-14121).

Research Areas for IL-17/IL-17A Antibody (NBP2-14121)

Find related products by research area.

Blogs on IL-17/IL-17A

There are no specific blogs for IL-17/IL-17A, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IL-17/IL-17A Antibody and receive a gift card or discount.


Gene Symbol IL17A