IL-13R alpha 1 Recombinant Protein Antigen

Images

 
There are currently no images for IL-13R alpha 1 Recombinant Protein Antigen (NBP2-55120PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-13R alpha 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL13RA1.

Source: E. coli

Amino Acid Sequence: ETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL13RA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55120.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-13R alpha 1 Recombinant Protein Antigen

  • bB128O4.2.1 (interleukin 13 receptor, alpha 1)
  • Cancer/testis antigen 19
  • CD213a1 antigen
  • CD213a1
  • CT19
  • IL-13 R alpha 1
  • IL13 receptor alpha-1 chain
  • IL-13 receptor subunit alpha-1
  • IL13R alpha 1
  • IL-13R subunit alpha-1
  • IL13R
  • IL13RA
  • IL-13Ra
  • IL13RA1
  • IL-13Ra1
  • IL-13R-alpha-1
  • interleukin 13 receptor, alpha 1
  • interleukin-13 receptor subunit alpha-1
  • NR4

Background

IL13 receptor alpha 1 is encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alph,a a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY413
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
AF146
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, Simple Western, WB
AF2167
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, Simple Western, WB
230-4RB
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
MAB4260
Species: Hu, Mu, Rt
Applications: Simple Western, WB
202-IL
Species: Hu
Applications: BA
NBP2-37737
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
M5000
Species: Mu
Applications: ELISA
AF284
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
485-MI
Species: Mu
Applications: BA
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB

Publications for IL-13R alpha 1 Recombinant Protein Antigen (NBP2-55120PEP) (0)

There are no publications for IL-13R alpha 1 Recombinant Protein Antigen (NBP2-55120PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-13R alpha 1 Recombinant Protein Antigen (NBP2-55120PEP) (0)

There are no reviews for IL-13R alpha 1 Recombinant Protein Antigen (NBP2-55120PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-13R alpha 1 Recombinant Protein Antigen (NBP2-55120PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-13R alpha 1 Products

Research Areas for IL-13R alpha 1 Recombinant Protein Antigen (NBP2-55120PEP)

Find related products by research area.

Blogs on IL-13R alpha 1

There are no specific blogs for IL-13R alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-13R alpha 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL13RA1