IL-13 R alpha 2 Antibody


Western Blot: IL13 receptor alpha 2 Antibody [NBP1-69687] - This Anti-IL13RA2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

IL-13 R alpha 2 Antibody Summary

Synthetic peptides corresponding to IL13RA2(interleukin 13 receptor, alpha 2) The peptide sequence was selected from the middle region of IL13RA2. Peptide sequence GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP.
This product is specific to Subunit or Isoform: alpha-2.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IL13RA2 and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IL-13 R alpha 2 Antibody

  • cancer/testis antigen 19
  • CD213a2 antigen
  • CD213a2
  • CT19
  • IL-13 R alpha 2
  • IL-13 receptor subunit alpha-2
  • IL13BP
  • IL13R alpha 2
  • IL-13R subunit alpha-2
  • IL13R
  • IL-13R
  • IL13RA2
  • IL-13Ra2
  • IL-13R-alpha-2
  • interleukin 13 binding protein
  • interleukin 13 receptor alpha 2 chain
  • interleukin 13 receptor, alpha 2
  • interleukin-13 receptor subunit alpha-2
  • Interleukin-13-binding protein


IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, Neut
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for IL-13 R alpha 2 Antibody (NBP1-69687) (0)

There are no publications for IL-13 R alpha 2 Antibody (NBP1-69687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-13 R alpha 2 Antibody (NBP1-69687) (0)

There are no reviews for IL-13 R alpha 2 Antibody (NBP1-69687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-13 R alpha 2 Antibody (NBP1-69687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IL-13 R alpha 2 Products

Bioinformatics Tool for IL-13 R alpha 2 Antibody (NBP1-69687)

Discover related pathways, diseases and genes to IL-13 R alpha 2 Antibody (NBP1-69687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-13 R alpha 2 Antibody (NBP1-69687)

Discover more about diseases related to IL-13 R alpha 2 Antibody (NBP1-69687).

Pathways for IL-13 R alpha 2 Antibody (NBP1-69687)

View related products by pathway.

PTMs for IL-13 R alpha 2 Antibody (NBP1-69687)

Learn more about PTMs related to IL-13 R alpha 2 Antibody (NBP1-69687).

Research Areas for IL-13 R alpha 2 Antibody (NBP1-69687)

Find related products by research area.

Blogs on IL-13 R alpha 2

There are no specific blogs for IL-13 R alpha 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IL-13 R alpha 2 Antibody and receive a gift card or discount.


Gene Symbol IL13RA2