IL-12 R beta 1 Antibody

Western Blot: IL-12 R beta 1 Antibody [H00003594-D01P] - Analysis of IL12RB1 expression in transfected 293T cell line by IL12RB1 polyclonal antibody.Lane 1: IL12RB1 transfected lysate(42.40 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

IL-12 R beta 1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: IL12RB1 (AAH29121.1, 1 a.a. - 381 a.a.) full-length human protein. MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF
• Specificity: Reacts with interleukin 12 receptor, beta 1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL12RB1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-12 R beta 1 Antibody

• CD212 antigen
• CD212
• IL-12 R beta 1
• IL-12 receptor beta component
• IL-12 receptor subunit beta-1
• IL12R beta 1
• IL-12R subunit beta-1
• IL12R
• IL12RB
• IL12RB1
• IL-12Rb1
• IL-12R-BETA1
• IL-12R-beta-1
• interleukin 12 receptor, beta 1
• interleukin-12 receptor beta-1 chain
• interleukin-12 receptor subunit beta-1
• MGC34454

Background

The protein encoded by this gene is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. This protein binds to interleukine 12 (IL12) with a low affinity, and is thought to be a part of IL12 receptor complex. This protein forms a disulfide-linked oligomer, which is required for its IL12 binding activity. The coexpression of this and IL12RB2 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The lack of expression of this gene was found to result in the immunodeficiency of patients with severe mycobacterial and Salmonella infections. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL12RB1
• Entrez:
  • 3594(Human)
• Uniprot:
  • AAH29121.1(Human)