IL-12 R beta 1 Antibody

Images

 
Western Blot: IL-12 R beta 1 Antibody [H00003594-D01P] - Analysis of IL12RB1 expression in transfected 293T cell line by IL12RB1 polyclonal antibody.Lane 1: IL12RB1 transfected lysate(42.40 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-12 R beta 1 Antibody Summary

Immunogen
IL12RB1 (AAH29121.1, 1 a.a. - 381 a.a.) full-length human protein. MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF
Specificity
Reacts with interleukin 12 receptor, beta 1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL12RB1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-12 R beta 1 Antibody

  • CD212 antigen
  • CD212
  • IL-12 R beta 1
  • IL-12 receptor beta component
  • IL-12 receptor subunit beta-1
  • IL12R beta 1
  • IL-12R subunit beta-1
  • IL12R
  • IL12RB
  • IL12RB1
  • IL-12Rb1
  • IL-12R-BETA1
  • IL-12R-beta-1
  • interleukin 12 receptor, beta 1
  • interleukin-12 receptor beta-1 chain
  • interleukin-12 receptor subunit beta-1
  • MGC34454

Background

The protein encoded by this gene is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. This protein binds to interleukine 12 (IL12) with a low affinity, and is thought to be a part of IL12 receptor complex. This protein forms a disulfide-linked oligomer, which is required for its IL12 binding activity. The coexpression of this and IL12RB2 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The lack of expression of this gene was found to result in the immunodeficiency of patients with severe mycobacterial and Salmonella infections. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB19591
Species: Hu
Applications: WB
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
MAB6731
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90223
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP

Publications for IL-12 R beta 1 Antibody (H00003594-D01P) (0)

There are no publications for IL-12 R beta 1 Antibody (H00003594-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-12 R beta 1 Antibody (H00003594-D01P) (0)

There are no reviews for IL-12 R beta 1 Antibody (H00003594-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-12 R beta 1 Antibody (H00003594-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-12 R beta 1 Products

Bioinformatics Tool for IL-12 R beta 1 Antibody (H00003594-D01P)

Discover related pathways, diseases and genes to IL-12 R beta 1 Antibody (H00003594-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-12 R beta 1 Antibody (H00003594-D01P)

Discover more about diseases related to IL-12 R beta 1 Antibody (H00003594-D01P).
 

Pathways for IL-12 R beta 1 Antibody (H00003594-D01P)

View related products by pathway.

PTMs for IL-12 R beta 1 Antibody (H00003594-D01P)

Learn more about PTMs related to IL-12 R beta 1 Antibody (H00003594-D01P).
 

Research Areas for IL-12 R beta 1 Antibody (H00003594-D01P)

Find related products by research area.

Blogs on IL-12 R beta 1

There are no specific blogs for IL-12 R beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-12 R beta 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL12RB1
Entrez
Uniprot