Recombinant Human IL-1 RII Protein

Images

 

Product Details

Summary
Product Discontinued
View other related IL-1 RII Peptides and Proteins

Order Details


    • Catalog Number
      H00007850-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human IL-1 RII Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21-120 of Human IL1R2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
IL1R2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL-1 RII Protein

  • beta
  • CD121b antigen
  • CD121b
  • IL-1 R beta
  • IL-1 RII
  • IL1R2
  • IL1RBCD121 antigen-like family member B
  • IL-1R-beta
  • IL1RII
  • IL-1RII
  • IL-1RT2
  • IL-1RT-2
  • interleukin 1 receptor, type II
  • Interleukin-1 receptor beta
  • MGC47725

Background

IL1R2 - interleukin 1 receptor, type II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF771
Species: Mu
Applications: WB, IHC, Neut
AF676
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF2940
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00007850-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for IL-1 RII Partial Recombinant Protein (H00007850-Q01) (0)

There are no publications for IL-1 RII Partial Recombinant Protein (H00007850-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-1 RII Partial Recombinant Protein (H00007850-Q01) (0)

There are no reviews for IL-1 RII Partial Recombinant Protein (H00007850-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-1 RII Partial Recombinant Protein (H00007850-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-1 RII Products

Bioinformatics Tool for IL-1 RII Partial Recombinant Protein (H00007850-Q01)

Discover related pathways, diseases and genes to IL-1 RII Partial Recombinant Protein (H00007850-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-1 RII Partial Recombinant Protein (H00007850-Q01)

Discover more about diseases related to IL-1 RII Partial Recombinant Protein (H00007850-Q01).
 

Pathways for IL-1 RII Partial Recombinant Protein (H00007850-Q01)

View related products by pathway.

PTMs for IL-1 RII Partial Recombinant Protein (H00007850-Q01)

Learn more about PTMs related to IL-1 RII Partial Recombinant Protein (H00007850-Q01).
 

Research Areas for IL-1 RII Partial Recombinant Protein (H00007850-Q01)

Find related products by research area.

Blogs on IL-1 RII

There are no specific blogs for IL-1 RII, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IL-1 RII Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IL1R2
Entrez