IL-1 beta/IL-1F2 Antibody

Images

 
Western Blot: IL-1 beta/IL-1F2 Antibody [H00003553-B01P] - Analysis of IL1B expression in transfected 293T cell line by IL1B polyclonal antibody. Lane 1: IL1B transfected lysate(29.59 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Product Discontinued
View other related IL-1 beta/IL-1F2 Primary Antibodies

Order Details


    • Catalog Number
      H00003553-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-1 beta/IL-1F2 Antibody Summary

Immunogen
IL1B (AAH08678.1, 1 a.a. - 269 a.a.) full-length human protein. MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Specificity
IL1B - interleukin 1, beta,
Clonality
Polyclonal
Host
Mouse
Gene
IL1B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-1 beta/IL-1F2 Antibody

  • catabolin
  • IL1 beta
  • IL-1 beta
  • IL-1
  • IL1B
  • IL-1b
  • IL1-BETA
  • IL-1F2
  • IL1F2IL-1 beta
  • interleukin 1, beta
  • interleukin-1 beta
  • preinterleukin 1 beta
  • pro-interleukin-1-beta

Background

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
796-IC
Species: Mu
H00003553-B01P
Species: Hu
Applications: WB

Publications for IL-1 beta/IL-1F2 Antibody (H00003553-B01P) (0)

There are no publications for IL-1 beta/IL-1F2 Antibody (H00003553-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-1 beta/IL-1F2 Antibody (H00003553-B01P) (0)

There are no reviews for IL-1 beta/IL-1F2 Antibody (H00003553-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-1 beta/IL-1F2 Antibody (H00003553-B01P). (Showing 1 - 1 of 1 FAQ).

  1. Do you have an antibody which recognize both IL1b uncleaved and cleaved forms?
    • Unfortunately all of our antibodies either recognize the mature (cleaved) form of IL1 beta or the native (uncleaved) form of IL1 beta. I have searched for an antibody that recognizes both, however the images I have seen only have one band on each blot which suggests that only one form is detected.

Secondary Antibodies

 

Isotype Controls

Additional IL-1 beta/IL-1F2 Products

Bioinformatics Tool for IL-1 beta/IL-1F2 Antibody (H00003553-B01P)

Discover related pathways, diseases and genes to IL-1 beta/IL-1F2 Antibody (H00003553-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-1 beta/IL-1F2 Antibody (H00003553-B01P)

Discover more about diseases related to IL-1 beta/IL-1F2 Antibody (H00003553-B01P).
 

Pathways for IL-1 beta/IL-1F2 Antibody (H00003553-B01P)

View related products by pathway.

PTMs for IL-1 beta/IL-1F2 Antibody (H00003553-B01P)

Learn more about PTMs related to IL-1 beta/IL-1F2 Antibody (H00003553-B01P).
 

Research Areas for IL-1 beta/IL-1F2 Antibody (H00003553-B01P)

Find related products by research area.

Blogs on IL-1 beta/IL-1F2.

IL-1 beta (interleukin 1 beta, lymphocyte activating factor (LAF))
IL-1 was originally identified and cloned as a lymphocyte mitogen and much later, was found to be comprised of two closely related but distinct proteins, interleukin 1 alpha (IL-1 alpha) and interleukin 1 beta (IL-1 beta). Both these proteins bind...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-1 beta/IL-1F2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL1B
Entrez
Uniprot