IL-1 alpha/IL-1F1 Antibody (4F9)

Images

 
Immunocytochemistry/ Immunofluorescence: IL-1 alpha/IL-1F1 Antibody (4F9) [H00003552-M04] - Analysis of monoclonal antibody to IL1A on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: IL-1 alpha/IL-1F1 Antibody (4F9) [H00003552-M04] - Detection limit for recombinant GST tagged IL1A is 0.3 ng/ml as a capture antibody.
Immunoprecipitation: IL-1 alpha/IL-1F1 Antibody (4F9) [H00003552-M04] - Analysis of IL1A transfected lysate using anti-IL1A monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL1A rabbit polyclonal ...read more

Product Details

Summary
Product Discontinued
View other related IL-1 alpha/IL-1F1 Primary Antibodies

Order Details


    • Catalog Number
      H00003552-M04
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-1 alpha/IL-1F1 Antibody (4F9) Summary

Immunogen
IL1A (AAH13142 172 a.a. - 271 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL1A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-1 alpha/IL-1F1 Antibody (4F9)

  • Hematopoietin-1
  • IL1 alpha
  • IL-1 alpha
  • IL1
  • IL1A
  • IL-1A
  • IL1-ALPHA
  • IL-1F1
  • IL1F1hematopoietin-1
  • interleukin 1, alpha
  • interleukin-1 alpha
  • preinterleukin 1 alpha
  • pro-interleukin-1-alpha

Background

Interleukin-1alpha is a member of the interleukin 1 cytokine family. It is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for IL-1 alpha/IL-1F1 Antibody (H00003552-M04) (0)

There are no publications for IL-1 alpha/IL-1F1 Antibody (H00003552-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-1 alpha/IL-1F1 Antibody (H00003552-M04) (0)

There are no reviews for IL-1 alpha/IL-1F1 Antibody (H00003552-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IL-1 alpha/IL-1F1 Antibody (H00003552-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-1 alpha/IL-1F1 Products

Bioinformatics Tool for IL-1 alpha/IL-1F1 Antibody (H00003552-M04)

Discover related pathways, diseases and genes to IL-1 alpha/IL-1F1 Antibody (H00003552-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-1 alpha/IL-1F1 Antibody (H00003552-M04)

Discover more about diseases related to IL-1 alpha/IL-1F1 Antibody (H00003552-M04).
 

Pathways for IL-1 alpha/IL-1F1 Antibody (H00003552-M04)

View related products by pathway.

PTMs for IL-1 alpha/IL-1F1 Antibody (H00003552-M04)

Learn more about PTMs related to IL-1 alpha/IL-1F1 Antibody (H00003552-M04).
 

Research Areas for IL-1 alpha/IL-1F1 Antibody (H00003552-M04)

Find related products by research area.

Blogs on IL-1 alpha/IL-1F1

There are no specific blogs for IL-1 alpha/IL-1F1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-1 alpha/IL-1F1 Antibody (4F9) and receive a gift card or discount.

Bioinformatics

Gene Symbol IL1A
Entrez
Uniprot