IKK beta Antibody (3C12)

Images

 
Immunocytochemistry/ Immunofluorescence: IKK beta Antibody (3C12) [H00003551-M08] - Analysis of monoclonal antibody to IKBKB on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: IKK beta Antibody (3C12) [H00003551-M08] - Detection limit for recombinant GST tagged IKBKB is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
3C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IKK beta Antibody (3C12) Summary

Immunogen
IKBKB (AAH06231, 3 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
Specificity
IKBKB (3C12)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IKBKB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Control
IKK beta Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IKK beta Antibody (3C12)

  • EC 2.7.11
  • EC 2.7.11.10
  • I-kappa-B kinase 2
  • I-kappa-B-kinase beta
  • IkBKB
  • IKK beta
  • IKK2
  • IKK2FLJ38368
  • IKK-B
  • IKK-betaFLJ36218
  • IKKBFLJ40509
  • inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
  • inhibitor of nuclear factor kappa-B kinase subunit beta
  • MGC131801
  • NFKBIKB
  • NFKBIKBFLJ33771
  • Nuclear factor NF-kappa-B inhibitor kinase beta

Background

NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00009448-M07
Species: Hu, Bv, Pa
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-56173
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
H00003551-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for IKK beta Antibody (H00003551-M08) (0)

There are no publications for IKK beta Antibody (H00003551-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKK beta Antibody (H00003551-M08) (0)

There are no reviews for IKK beta Antibody (H00003551-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IKK beta Antibody (H00003551-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IKK beta Products

Bioinformatics Tool for IKK beta Antibody (H00003551-M08)

Discover related pathways, diseases and genes to IKK beta Antibody (H00003551-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IKK beta Antibody (H00003551-M08)

Discover more about diseases related to IKK beta Antibody (H00003551-M08).
 

Pathways for IKK beta Antibody (H00003551-M08)

View related products by pathway.

PTMs for IKK beta Antibody (H00003551-M08)

Learn more about PTMs related to IKK beta Antibody (H00003551-M08).
 

Research Areas for IKK beta Antibody (H00003551-M08)

Find related products by research area.

Blogs on IKK beta.

Regulating Immune Response Pathways with IKK beta
IKK beta, also known as IKK2, activates the NFkB complex by phosphorylating the NFkB inhibitor, IkBa. Several transcript variants, some protein-coding and some not, have been found for IKKB. The Nuclear Factor-kappa B (NF-kB) family of transcription f...  Read full blog post.

IKK alpha: Roles in Development, B-cell Survival and ESC Differentiation
Inhibitor of nuclear factor kappa-B kinase subunit alpha (IKK1 alpha) is a serine/threonine kinase that forms a complex with IKK beta and NEMO. It plays an essential role in embryonic skin development. Mice with low levels of IKKa show an increase in...  Read full blog post.

Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IKK beta Antibody (3C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol IKBKB
Entrez
OMIM
Uniprot