IKK alpha Antibody (2G4)

Images

 
Western Blot: IKK alpha Antibody (2G4) [H00001147-M04] - Analysis of CHUK expression in Jurkat (Cat # L017V1).
Immunocytochemistry/ Immunofluorescence: IKK alpha Antibody (2G4) [H00001147-M04] - Analysis of monoclonal antibody to CHUK on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: IKK alpha Antibody (2G4) [H00001147-M04] - Analysis of monoclonal antibody to CHUK on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Proximity Ligation Assay: IKK alpha Antibody (2G4) [H00001147-M04] - Analysis of protein-protein interactions between IKBKB and CHUK. HeLa cells were stained with anti-IKBKB rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, PLA
Clone
2G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IKK alpha Antibody (2G4) Summary

Immunogen
CHUK (NP_001269 646 a.a. - 745 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE
Localization
Cytoplasmic and Nuclear
Specificity
CHUK - conserved helix-loop-helix ubiquitous kinase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHUK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publication using H00001147-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IKK alpha Antibody (2G4)

  • CHUK
  • conserved helix-loop-helix ubiquitous kinaseIKBKA
  • EC 2.7.11
  • EC 2.7.11.10
  • I-kappa-B kinase 1
  • I-kappa-B kinase alpha
  • IkappaB kinase
  • IkBKA
  • IkBKalpha
  • IKK alpha
  • IKK1
  • IKK1I-kappa-B kinase-alpha
  • IKK-A
  • IKKAIkB kinase alpha subunit
  • IKK-alphainhibitor of nuclear factor kappa-B kinase subunit alpha
  • NFKBIKA
  • NFKBIKAIKK-a kinase
  • Nuclear factor NFkappaB inhibitor kinase alpha
  • Nuclear factor NF-kappa-B inhibitor kinase alpha
  • TCF16
  • TCF-16
  • Transcription factor 16

Background

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
MAB3199
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6027
Species: Hu
Applications: WB
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
H00001147-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA

Publications for IKK alpha Antibody (H00001147-M04)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for IKK alpha Antibody (H00001147-M04) (0)

There are no reviews for IKK alpha Antibody (H00001147-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IKK alpha Antibody (H00001147-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IKK alpha Products

Bioinformatics Tool for IKK alpha Antibody (H00001147-M04)

Discover related pathways, diseases and genes to IKK alpha Antibody (H00001147-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IKK alpha Antibody (H00001147-M04)

Discover more about diseases related to IKK alpha Antibody (H00001147-M04).
 

Pathways for IKK alpha Antibody (H00001147-M04)

View related products by pathway.

PTMs for IKK alpha Antibody (H00001147-M04)

Learn more about PTMs related to IKK alpha Antibody (H00001147-M04).
 

Research Areas for IKK alpha Antibody (H00001147-M04)

Find related products by research area.

Blogs on IKK alpha.

IKK alpha says "no" to NFk beta
The nuclear factor kappa B (NFkB) is a ubiquitous transcription factor essential for the activation of immune and inflammatory responses. NFkB activity is inhibited when it is associated with IkB proteins in the cell cytoplasm. IkB proteins are phosph...  Read full blog post.

Regulating Immune Response Pathways with IKK beta
IKK beta, also known as IKK2, activates the NFkB complex by phosphorylating the NFkB inhibitor, IkBa. Several transcript variants, some protein-coding and some not, have been found for IKKB. The Nuclear Factor-kappa B (NF-kB) family of transcription f...  Read full blog post.

IKK alpha: Roles in Development, B-cell Survival and ESC Differentiation
Inhibitor of nuclear factor kappa-B kinase subunit alpha (IKK1 alpha) is a serine/threonine kinase that forms a complex with IKK beta and NEMO. It plays an essential role in embryonic skin development. Mice with low levels of IKKa show an increase in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IKK alpha Antibody (2G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CHUK
Entrez
OMIM
Uniprot