IGSF4C/SynCAM4 Antibody

Images

 
Western Blot: IGSF4C/SynCAM4 Antibody [NBP1-89636] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: IGSF4C/SynCAM4 Antibody [NBP1-89636] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nuclear membrane.
Immunohistochemistry-Paraffin: IGSF4C/SynCAM4 Antibody [NBP1-89636] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: IGSF4C/SynCAM4 Antibody [NBP1-89636] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGSF4C/SynCAM4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CADM4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IGSF4C/SynCAM4 Protein (NBP1-89636PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGSF4C/SynCAM4 Antibody

  • CADM4
  • cell adhesion molecule 4
  • IGSF4C
  • IGSF4Cnectin-like 4
  • Immunoglobulin superfamily member 4C
  • immunoglobulin superfamily, member 4C
  • Necl-4
  • NECL4synCAM4
  • Nectin-like protein 4
  • SynCAM4
  • TSLC1-like 2
  • TSLC1-like protein 2
  • TSLL2
  • TSLL2SynCAM4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
MAB3678
Species: Hu
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90325
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP2-30604
Species: Hu
Applications: IHC, IHC-P
AF2659
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB6798
Species: Hu
Applications: WB, ICC
NB600-1015
Species: Mu, Hu(-)
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31650
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr

Publications for IGSF4C/SynCAM4 Antibody (NBP1-89636) (0)

There are no publications for IGSF4C/SynCAM4 Antibody (NBP1-89636).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF4C/SynCAM4 Antibody (NBP1-89636) (0)

There are no reviews for IGSF4C/SynCAM4 Antibody (NBP1-89636). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IGSF4C/SynCAM4 Antibody (NBP1-89636) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGSF4C/SynCAM4 Products

Bioinformatics Tool for IGSF4C/SynCAM4 Antibody (NBP1-89636)

Discover related pathways, diseases and genes to IGSF4C/SynCAM4 Antibody (NBP1-89636). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF4C/SynCAM4 Antibody (NBP1-89636)

Discover more about diseases related to IGSF4C/SynCAM4 Antibody (NBP1-89636).
 

Pathways for IGSF4C/SynCAM4 Antibody (NBP1-89636)

View related products by pathway.

PTMs for IGSF4C/SynCAM4 Antibody (NBP1-89636)

Learn more about PTMs related to IGSF4C/SynCAM4 Antibody (NBP1-89636).

Blogs on IGSF4C/SynCAM4

There are no specific blogs for IGSF4C/SynCAM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGSF4C/SynCAM4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CADM4
Entrez