IGSF2/CD101 Antibody

Images

 
Immunohistochemistry-Paraffin: IGSF2/CD101 Antibody [NBP2-31687] - Staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: IGSF2/CD101 Antibody [NBP2-31687] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: IGSF2/CD101 Antibody [NBP2-31687] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: IGSF2/CD101 Antibody [NBP2-31687] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: IGSF2/CD101 Antibody [NBP2-31687] - Staining in human lung and liver tissues. Corresponding CD101 RNA-seq data are presented for the same tissues.

Product Details

Summary
Product Discontinued
View other related IGSF2/CD101 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-31687
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IGSF2/CD101 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NSRSQVQELSINSNTDIECSILSRSNGNLQLAIIWYFSPVSTNASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKVSQD
Specificity
Specificity of human IGSF2/CD101 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD101
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGSF2/CD101 Antibody

  • CD101 antigen
  • CD101 molecule
  • CD101
  • Cell surface glycoprotein V7
  • EWI101
  • EWI-101
  • Glu-Trp-Ile EWI motif-containing protein 101
  • IGSF2
  • Leukocyte Surface Protein
  • member 2
  • V7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00028299-P01
Species: Hu
AF1360
Species: Mu
Applications: WB, IHC
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3117
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF4788
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-84255
Species: Hu
Applications: IHC, IHC-P
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
AF937
Species: Mu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready
NBP2-31687
Species: Hu
Applications: IHC, IHC-P

Publications for IGSF2/CD101 Antibody (NBP2-31687) (0)

There are no publications for IGSF2/CD101 Antibody (NBP2-31687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF2/CD101 Antibody (NBP2-31687) (0)

There are no reviews for IGSF2/CD101 Antibody (NBP2-31687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IGSF2/CD101 Antibody (NBP2-31687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGSF2/CD101 Products

Bioinformatics Tool for IGSF2/CD101 Antibody (NBP2-31687)

Discover related pathways, diseases and genes to IGSF2/CD101 Antibody (NBP2-31687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF2/CD101 Antibody (NBP2-31687)

Discover more about diseases related to IGSF2/CD101 Antibody (NBP2-31687).
 

Pathways for IGSF2/CD101 Antibody (NBP2-31687)

View related products by pathway.

PTMs for IGSF2/CD101 Antibody (NBP2-31687)

Learn more about PTMs related to IGSF2/CD101 Antibody (NBP2-31687).

Blogs on IGSF2/CD101

There are no specific blogs for IGSF2/CD101, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGSF2/CD101 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD101
Entrez
Uniprot