IGSF2/CD101 Antibody


Immunohistochemistry-Paraffin: IGSF2/CD101 Antibody [NBP2-31687] - Staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: IGSF2/CD101 Antibody [NBP2-31687] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: IGSF2/CD101 Antibody [NBP2-31687] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: IGSF2/CD101 Antibody [NBP2-31687] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

IGSF2/CD101 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: NSRSQVQELSINSNTDIECSILSRSNGNLQLAIIWYFSPVSTNASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKVSQD
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IGSF2/CD101 Protein (NBP2-31687PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IGSF2/CD101 Antibody

  • CD101 antigen
  • CD101 molecule
  • CD101
  • Cell surface glycoprotein V7
  • EWI101
  • EWI-101
  • Glu-Trp-Ile EWI motif-containing protein 101
  • IGSF2
  • Leukocyte Surface Protein
  • member 2
  • V7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ELISA, PLA
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, AgAct
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: IHC, IHC-P

Publications for IGSF2/CD101 Antibody (NBP2-31687) (0)

There are no publications for IGSF2/CD101 Antibody (NBP2-31687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF2/CD101 Antibody (NBP2-31687) (0)

There are no reviews for IGSF2/CD101 Antibody (NBP2-31687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IGSF2/CD101 Antibody (NBP2-31687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IGSF2/CD101 Products

Bioinformatics Tool for IGSF2/CD101 Antibody (NBP2-31687)

Discover related pathways, diseases and genes to IGSF2/CD101 Antibody (NBP2-31687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF2/CD101 Antibody (NBP2-31687)

Discover more about diseases related to IGSF2/CD101 Antibody (NBP2-31687).

Pathways for IGSF2/CD101 Antibody (NBP2-31687)

View related products by pathway.

PTMs for IGSF2/CD101 Antibody (NBP2-31687)

Learn more about PTMs related to IGSF2/CD101 Antibody (NBP2-31687).

Blogs on IGSF2/CD101

There are no specific blogs for IGSF2/CD101, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IGSF2/CD101 Antibody and receive a gift card or discount.


Gene Symbol CD101