Recombinant Human IGLV3-21 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IGLV3-21 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-233 of Human IGLV3-21 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAWTVLLLGLLSHCTVSVTSYVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVMVVYDDSDRPSGIPERLSGSNSGNTATLTISRVEAGDEADYYCQVWDSTSNHYVFGTGTKVSVLSQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
IGLV3-21

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IGLV3-21 Protein

  • IGLV321
  • immunoglobulin lambda variable 3-21
  • V2-14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00028299-P01
Species: Hu
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00028815-P01
Species: Hu
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready

Publications for IGLV3-21 Recombinant Protein (H00028796-P01) (0)

There are no publications for IGLV3-21 Recombinant Protein (H00028796-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGLV3-21 Recombinant Protein (H00028796-P01) (0)

There are no reviews for IGLV3-21 Recombinant Protein (H00028796-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGLV3-21 Recombinant Protein (H00028796-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IGLV3-21 Products

IGLV3-21 H00028796-P01

Bioinformatics Tool for IGLV3-21 Recombinant Protein (H00028796-P01)

Discover related pathways, diseases and genes to IGLV3-21 Recombinant Protein (H00028796-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGLV3-21 Recombinant Protein (H00028796-P01)

Discover more about diseases related to IGLV3-21 Recombinant Protein (H00028796-P01).
 

Pathways for IGLV3-21 Recombinant Protein (H00028796-P01)

View related products by pathway.

Blogs on IGLV3-21

There are no specific blogs for IGLV3-21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IGLV3-21 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IGLV3-21