Recombinant Human IGHG1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IGHG1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 479 of Human IGHG1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MELGLSWIFLLAILKGVQCEVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQVPGKGLEWVSGISCNSGSIGYADSVKGRFTISRDNAKKSLYLQMNSLRAEDTALYYCAKDIELDIVVVPAPMRGSLGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
IGHG1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IGHG1 Protein

  • immunoglobulin heavy constant gamma 1 (G1m marker)

Background

IGHG1( AAH06402, 1 a.a. - 480 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DDXCH02P-100
Species: Hu
Applications: IHC-Fr, IHC-P, Flow-CS, Flow-IC, IF
NBP1-74190
Species: Mu
Applications: WB, ChIP
DDXCH04A488-100
Species: Hu
Applications: Flow-CS, Flow-IC, IF
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00003494-B01P
Species: Hu
Applications: WB, ICC/IF
AF4409
Species: Mu
Applications: WB
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF8537
Species: Mu, Rt
Applications: WB, Simple Western, ICC
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC

Publications for IGHG1 Recombinant Protein (H00003500-P01) (0)

There are no publications for IGHG1 Recombinant Protein (H00003500-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGHG1 Recombinant Protein (H00003500-P01) (0)

There are no reviews for IGHG1 Recombinant Protein (H00003500-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGHG1 Recombinant Protein (H00003500-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IGHG1 Products

Bioinformatics Tool for IGHG1 Recombinant Protein (H00003500-P01)

Discover related pathways, diseases and genes to IGHG1 Recombinant Protein (H00003500-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGHG1 Recombinant Protein (H00003500-P01)

Discover more about diseases related to IGHG1 Recombinant Protein (H00003500-P01).
 

Pathways for IGHG1 Recombinant Protein (H00003500-P01)

View related products by pathway.

PTMs for IGHG1 Recombinant Protein (H00003500-P01)

Learn more about PTMs related to IGHG1 Recombinant Protein (H00003500-P01).
 

Research Areas for IGHG1 Recombinant Protein (H00003500-P01)

Find related products by research area.

Blogs on IGHG1

There are no specific blogs for IGHG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IGHG1 Antibody (IG507R)
NBP2-53145-100ug
CD20 Antibody (AISB12)
NBP1-43435-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IGHG1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IGHG1