IGFBP-3 Antibody

Images

 
Western Blot: IGFBP-3 Antibody [NBP1-88374] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: IGFBP-3 Antibody [NBP1-88374] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Product Discontinued
View other related IGFBP-3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88374
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IGFBP-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGFBP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publications using NBP1-88374.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGFBP-3 Antibody

  • acid stable subunit of the 140 K IGF complex
  • binding protein 29
  • binding protein 53
  • growth hormone-dependent binding protein
  • IBP-3
  • IBP3BP-53
  • IGF-binding protein 3
  • IGFBP3
  • IGFBP-3
  • insulin-like growth factor binding protein 3
  • insulin-like growth factor-binding protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF674
Species: Hu
Applications: WB, Simple Western, Neut
NBP1-80549
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF875
Species: Hu
Applications: WB, IHC
AF1360
Species: Mu
Applications: WB, IHC
AF1436
Species: Mu
Applications: WB
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF776
Species: Mu
Applications: WB, IHC
MAB391
Species: Hu, Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for IGFBP-3 Antibody (NBP1-88374)(2)

Reviews for IGFBP-3 Antibody (NBP1-88374) (0)

There are no reviews for IGFBP-3 Antibody (NBP1-88374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGFBP-3 Antibody (NBP1-88374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGFBP-3 Products

Bioinformatics Tool for IGFBP-3 Antibody (NBP1-88374)

Discover related pathways, diseases and genes to IGFBP-3 Antibody (NBP1-88374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGFBP-3 Antibody (NBP1-88374)

Discover more about diseases related to IGFBP-3 Antibody (NBP1-88374).
 

Pathways for IGFBP-3 Antibody (NBP1-88374)

View related products by pathway.

PTMs for IGFBP-3 Antibody (NBP1-88374)

Learn more about PTMs related to IGFBP-3 Antibody (NBP1-88374).
 

Research Areas for IGFBP-3 Antibody (NBP1-88374)

Find related products by research area.

Blogs on IGFBP-3

There are no specific blogs for IGFBP-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGFBP-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGFBP3
Entrez