IGFALS Antibody

Images

 
Western Blot: IGFALS Antibody [NBP1-89118] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: IGFALS Antibody [NBP1-89118] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: IGFALS Antibody [NBP1-89118] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGFALS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGFALS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IGFALS Protein (NBP1-89118PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGFALS Antibody

  • ALSinsulin-like growth factor binding protein complex acid labile chain
  • insulin-like growth factor binding protein, acid labile subunit
  • insulin-like growth factor-binding protein complex acid labile subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for IGFALS Antibody (NBP1-89118) (0)

There are no publications for IGFALS Antibody (NBP1-89118).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGFALS Antibody (NBP1-89118) (0)

There are no reviews for IGFALS Antibody (NBP1-89118). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IGFALS Antibody (NBP1-89118) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGFALS Products

Bioinformatics Tool for IGFALS Antibody (NBP1-89118)

Discover related pathways, diseases and genes to IGFALS Antibody (NBP1-89118). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGFALS Antibody (NBP1-89118)

Discover more about diseases related to IGFALS Antibody (NBP1-89118).
 

Pathways for IGFALS Antibody (NBP1-89118)

View related products by pathway.

PTMs for IGFALS Antibody (NBP1-89118)

Learn more about PTMs related to IGFALS Antibody (NBP1-89118).

Blogs on IGFALS

There are no specific blogs for IGFALS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGFALS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGFALS