Recombinant Human IGF-II Protein

Images

 
There are currently no images for IGF-II Biologically Active Protein (NBP2-26544).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Bioactivity
Concentration
LYOPH

Order Details

Recombinant Human IGF-II Protein Summary

Description
Recombinant biologically active IGF2 protein.

Source:E. coli

Amino Acid Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Details of Functionality
Recombinant Human Insulin Like Growth Factor-II is fully biologically active when compared to standards.The ED50, calculated by the dose-dependent induction of MCF-7 cell proliferation was found to be 0.85ng/ml corresponding to a Specific Activity of 1,176,470 IU/mg.
Source
E. coli
Protein/Peptide Type
Recombinant Protein
Gene
IGF2
Purity
> 97 % pure by SDS-PAGE and HPLC
Endotoxin Note
Less than 0.1 ng/ug (IEU/ug) of IGF-II.

Applications/Dilutions

Theoretical MW
7.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP2-26544.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
Lyophilized with no additives.
Preservative
No Preservative
Concentration
LYOPH
Purity
> 97 % pure by SDS-PAGE and HPLC
Reconstitution Instructions
Reconstitute with sterilized 18 M omega-cm water to a final concentration of at least 0.1 mg/ml.

Notes

After reconstitution, store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Alternate Names for Recombinant Human IGF-II Protein

  • C11orf43
  • chromosome 11 open reading frame 43
  • FLJ22066
  • FLJ44734
  • IGF2
  • IGF-2
  • IGFII
  • IGF-II
  • insulin-like growth factor 2 (somatomedin A)
  • insulin-like growth factor II
  • insulin-like growth factor type 2
  • MSA
  • PP9974
  • somatomedin-A

Background

IGF-2 is a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3' region and to the upstream INS gene at the 5' region. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF674
Species: Hu
Applications: WB, Simple Western, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
MAB391
Species: Hu, Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP1-80549
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF776
Species: Mu
Applications: WB, IHC
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IGF-II Biologically Active Protein (NBP2-26544)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for IGF-II Biologically Active Protein (NBP2-26544) (0)

There are no reviews for IGF-II Biologically Active Protein (NBP2-26544). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for IGF-II Biologically Active Protein (NBP2-26544) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for IGF-II Biologically Active Protein (NBP2-26544)

Discover related pathways, diseases and genes to IGF-II Biologically Active Protein (NBP2-26544). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGF-II Biologically Active Protein (NBP2-26544)

Discover more about diseases related to IGF-II Biologically Active Protein (NBP2-26544).
 

Pathways for IGF-II Biologically Active Protein (NBP2-26544)

View related products by pathway.

PTMs for IGF-II Biologically Active Protein (NBP2-26544)

Learn more about PTMs related to IGF-II Biologically Active Protein (NBP2-26544).
 

Research Areas for IGF-II Biologically Active Protein (NBP2-26544)

Find related products by research area.

Blogs on IGF-II

There are no specific blogs for IGF-II, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IGF-II
292-G2-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IGF-II Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IGF2
Entrez