IFRD1 Antibody

Images

 
Western Blot: IFRD1 Antibody [NBP1-52851] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: IFRD1 Antibody [NBP1-52851] - Human Adult Adrenal Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFRD1 Antibody Summary

Immunogen
Synthetic peptides corresponding to IFRD1(interferon-related developmental regulator 1) The peptide sequence was selected from the N terminal of IFRD1. Peptide sequence VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFRD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against IFRD1 and was validated on Western blot.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IFRD1 Antibody

  • 12-O-tetradecanoylphorbol-13-acetate-induced sequence 7
  • interferon-related developmental regulator 1
  • Nerve growth factor-inducible protein PC4
  • PC4
  • pheochromocytoma cell-4
  • TIS7
  • TPA induced sequence 7

Background

IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
2984-SE
Species: Hu
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00007866-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-52851
Species: Hu
Applications: WB, IHC

Publications for IFRD1 Antibody (NBP1-52851) (0)

There are no publications for IFRD1 Antibody (NBP1-52851).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFRD1 Antibody (NBP1-52851) (0)

There are no reviews for IFRD1 Antibody (NBP1-52851). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFRD1 Antibody (NBP1-52851) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFRD1 Products

Bioinformatics Tool for IFRD1 Antibody (NBP1-52851)

Discover related pathways, diseases and genes to IFRD1 Antibody (NBP1-52851). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFRD1 Antibody (NBP1-52851)

Discover more about diseases related to IFRD1 Antibody (NBP1-52851).
 

Pathways for IFRD1 Antibody (NBP1-52851)

View related products by pathway.

PTMs for IFRD1 Antibody (NBP1-52851)

Learn more about PTMs related to IFRD1 Antibody (NBP1-52851).

Blogs on IFRD1

There are no specific blogs for IFRD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFRD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFRD1
Uniprot