IFN-omega/IFNW1 Antibody

Images

 
There are currently no images for IFN-omega/IFNW1 Antibody (H00003467-A01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IFN-omega/IFNW1 Antibody Summary

Immunogen
IFNW1 (NP_002168, 22 a.a. - 104 a.a.) partial recombinant protein with GST tag. LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IFNW1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFN-omega/IFNW1 Antibody

  • IFN-omega 1, interferon omega-1
  • IFNomega
  • IFN-omega
  • IFNW1
  • Interferon alpha-II-1
  • interferon omega-1
  • interferon, omega 1

Background

IFNW1 (Human) ELISA Kit is a sandwich enzyme immunoassay for the quantitative measurement of human IFN-omega.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5117
Species: Hu
Applications: WB, IHC
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003451-D01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-13495
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF1674
Species: Mu
Applications: WB
H00003467-A01
Species: Hu
Applications: WB, ELISA

Publications for IFN-omega/IFNW1 Antibody (H00003467-A01) (0)

There are no publications for IFN-omega/IFNW1 Antibody (H00003467-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-omega/IFNW1 Antibody (H00003467-A01) (0)

There are no reviews for IFN-omega/IFNW1 Antibody (H00003467-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-omega/IFNW1 Antibody (H00003467-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFN-omega/IFNW1 Products

Bioinformatics Tool for IFN-omega/IFNW1 Antibody (H00003467-A01)

Discover related pathways, diseases and genes to IFN-omega/IFNW1 Antibody (H00003467-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFN-omega/IFNW1 Antibody (H00003467-A01)

Discover more about diseases related to IFN-omega/IFNW1 Antibody (H00003467-A01).
 

Pathways for IFN-omega/IFNW1 Antibody (H00003467-A01)

View related products by pathway.

Research Areas for IFN-omega/IFNW1 Antibody (H00003467-A01)

Find related products by research area.

Blogs on IFN-omega/IFNW1

There are no specific blogs for IFN-omega/IFNW1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-omega/IFNW1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNW1
Entrez