IFN-gamma Antibody

Images

 
Western Blot: IFN-gamma Antibody [H00003458-B02P] - Analysis of IFNG expression in transfected 293T cell line by IFNG polyclonal antibody. Lane 1: IFNG transfected lysate(18.26 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related IFN-gamma Primary Antibodies

Order Details


    • Catalog Number
      H00003458-B02P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IFN-gamma Antibody Summary

Immunogen
IFNG (NP_000610, 1 a.a. - 166 a.a.) full-length human protein. MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Clonality
Polyclonal
Host
Mouse
Gene
IFNG
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFN-gamma Antibody

  • IFG
  • IFI
  • IFNG
  • IFNgamma
  • IFN-gamma
  • Immune interferon
  • interferon gamma
  • interferon, gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS

Publications for IFN-gamma Antibody (H00003458-B02P) (0)

There are no publications for IFN-gamma Antibody (H00003458-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-gamma Antibody (H00003458-B02P) (0)

There are no reviews for IFN-gamma Antibody (H00003458-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-gamma Antibody (H00003458-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFN-gamma Products

Bioinformatics Tool for IFN-gamma Antibody (H00003458-B02P)

Discover related pathways, diseases and genes to IFN-gamma Antibody (H00003458-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFN-gamma Antibody (H00003458-B02P)

Discover more about diseases related to IFN-gamma Antibody (H00003458-B02P).
 

Pathways for IFN-gamma Antibody (H00003458-B02P)

View related products by pathway.

PTMs for IFN-gamma Antibody (H00003458-B02P)

Learn more about PTMs related to IFN-gamma Antibody (H00003458-B02P).
 

Research Areas for IFN-gamma Antibody (H00003458-B02P)

Find related products by research area.

Blogs on IFN-gamma.

iNOS: The Nitric Oxide Boss
Nitric oxide (NO) is an inorganic, gaseous, and reactive free radical that acts as a biologic mediator in processes such as neurotransmission, vasorelaxation, and cytotoxicity. In addition, it has antimicrobial and anti-tumoral activities. NO producti...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-gamma Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNG
Entrez
Uniprot