IFN-alpha D Antibody (3C6)

Images

 
ELISA: IFN-alpha D Antibody (3C6) [H00003439-M07] - Detection limit for recombinant GST tagged IFNA1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IFN-alpha D Antibody (3C6) Summary

Immunogen
IFNA1 (NP_076918, 24 a.a. - 133 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETP
Specificity
IFNA1 (3C6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IFNA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFN-alpha D Antibody (3C6)

  • IFL
  • IFN
  • IFNA13
  • IFNAalphaIFN-alpha-1/13
  • IFN-alpha 1b
  • IFNalpha D
  • IFN-alpha D
  • IFN-ALPHA
  • IFN-alphaD
  • interferon alpha 1b
  • interferon alpha-1/13
  • Interferon alpha-D
  • interferon, alpha 1
  • LeIF D
  • MGC138207
  • MGC138505
  • MGC138507

Background

Leukocyte interferon is produced predominantly by B lymphocytes. Immune interferon (IFN-gamma; MIM 147570) is produced by mitogen- or antigen-stimulated T lymphocytes.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF2890
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF5629
Species: Hu, Mu
Applications: WB
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
AF4715
Species: Mu
Applications: WB
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
H00003439-M07
Species: Hu
Applications: WB, ELISA

Publications for IFN-alpha D Antibody (H00003439-M07) (0)

There are no publications for IFN-alpha D Antibody (H00003439-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-alpha D Antibody (H00003439-M07) (0)

There are no reviews for IFN-alpha D Antibody (H00003439-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-alpha D Antibody (H00003439-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFN-alpha D Products

Bioinformatics Tool for IFN-alpha D Antibody (H00003439-M07)

Discover related pathways, diseases and genes to IFN-alpha D Antibody (H00003439-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFN-alpha D Antibody (H00003439-M07)

Discover more about diseases related to IFN-alpha D Antibody (H00003439-M07).
 

Pathways for IFN-alpha D Antibody (H00003439-M07)

View related products by pathway.

PTMs for IFN-alpha D Antibody (H00003439-M07)

Learn more about PTMs related to IFN-alpha D Antibody (H00003439-M07).
 

Research Areas for IFN-alpha D Antibody (H00003439-M07)

Find related products by research area.

Blogs on IFN-alpha D

There are no specific blogs for IFN-alpha D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-alpha D Antibody (3C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNA1
Entrez
OMIM
Uniprot