Recombinant Human IFITM2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IFITM2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21551 of Human IFITM2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGAPHNPAPPTSTVIHIRSETSVPDHVVW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
IFITM2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IFITM2 Protein

  • 1-8D
  • IFITM2
  • interferon induced transmembrane protein 2 (1-8D)
  • interferon-induced transmembrane protein 2
  • Interferon-inducible protein 1-8D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89345
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3377
Species: Mu
Applications: WB, IHC
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-90348
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00003304-M02
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
H00000343-M01
Species: Hu, Rt
Applications: WB, ELISA
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBL1-11832
Species: Hu
NBP1-90752
Species: Hu
Applications: IHC, IHC-P
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IP
H00010581-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for IFITM2 Partial Recombinant Protein (H00010581-Q01) (0)

There are no publications for IFITM2 Partial Recombinant Protein (H00010581-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFITM2 Partial Recombinant Protein (H00010581-Q01) (0)

There are no reviews for IFITM2 Partial Recombinant Protein (H00010581-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFITM2 Partial Recombinant Protein (H00010581-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFITM2 Products

Bioinformatics Tool for IFITM2 Partial Recombinant Protein (H00010581-Q01)

Discover related pathways, diseases and genes to IFITM2 Partial Recombinant Protein (H00010581-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFITM2 Partial Recombinant Protein (H00010581-Q01)

Discover more about diseases related to IFITM2 Partial Recombinant Protein (H00010581-Q01).
 

Pathways for IFITM2 Partial Recombinant Protein (H00010581-Q01)

View related products by pathway.

Blogs on IFITM2

There are no specific blogs for IFITM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IFITM2 Antibody
H00010581-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IFITM2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IFITM2
Entrez