Recombinant Human IFIT1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IFIT1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 318 - 420 of Human IFIT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN

Protein/Peptide Type
Partial Recombinant Protein
Gene
IFIT1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IFIT1 Protein

  • G10P1C56
  • GARG-16
  • IFI56IFI-56
  • IFI-56K
  • IFIT-1
  • IFNAI1ISG56
  • Interferon, alpha-inducible protein (MW 56kD)
  • Interferon-induced 56 kDa protein
  • interferon-induced protein 56
  • interferon-induced protein with tetratricopeptide repeats 1
  • p56
  • RNM561

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7500
Species: Hu
Applications: WB, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89747
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-02148
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for IFIT1 Partial Recombinant Protein (H00003434-Q01) (0)

There are no publications for IFIT1 Partial Recombinant Protein (H00003434-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFIT1 Partial Recombinant Protein (H00003434-Q01) (0)

There are no reviews for IFIT1 Partial Recombinant Protein (H00003434-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFIT1 Partial Recombinant Protein (H00003434-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFIT1 Products

Bioinformatics Tool for IFIT1 Partial Recombinant Protein (H00003434-Q01)

Discover related pathways, diseases and genes to IFIT1 Partial Recombinant Protein (H00003434-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFIT1 Partial Recombinant Protein (H00003434-Q01)

Discover more about diseases related to IFIT1 Partial Recombinant Protein (H00003434-Q01).
 

Pathways for IFIT1 Partial Recombinant Protein (H00003434-Q01)

View related products by pathway.

PTMs for IFIT1 Partial Recombinant Protein (H00003434-Q01)

Learn more about PTMs related to IFIT1 Partial Recombinant Protein (H00003434-Q01).

Blogs on IFIT1.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also...  Read full blog post.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IFIT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IFIT1