IFI6 Antibody (M2)

Images

 
There are currently no images for IFI6 Antibody (H00002537-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
M2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IFI6 Antibody (M2) Summary

Immunogen
G1P3 (AAH11601, 1 a.a. - 130 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSCVVIGNIGALMGYATHKYLDSEEDEE
Specificity
G1P3 - interferon, alpha-inducible protein (clone IFI-6-16)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IFI6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFI6 Antibody (M2)

  • FAM14C
  • G1P3interferon alpha-inducible protein 6, 6-16
  • Ifi-6-16
  • IFI616interferon, alpha-inducible protein (clone IFI-6-16)
  • interferon, alpha-inducible protein 6
  • interferon, alpha-inducible protein clone IFI-6-16
  • Interferon-induced protein 6-16

Background

This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84745
Species: Hu
Applications: IHC, IHC-P
AF5629
Species: Hu, Mu
Applications: WB
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP2-03972
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-02340
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF8519
Species: Hu, Mu, Rt
Applications: WB
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2890
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-57838
Species: Hu
Applications: WB, IHC, IHC-P
AF3377
Species: Mu
Applications: WB, IHC

Publications for IFI6 Antibody (H00002537-M02) (0)

There are no publications for IFI6 Antibody (H00002537-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFI6 Antibody (H00002537-M02) (0)

There are no reviews for IFI6 Antibody (H00002537-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IFI6 Antibody (H00002537-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFI6 Products

Bioinformatics Tool for IFI6 Antibody (H00002537-M02)

Discover related pathways, diseases and genes to IFI6 Antibody (H00002537-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFI6 Antibody (H00002537-M02)

Discover more about diseases related to IFI6 Antibody (H00002537-M02).
 

Pathways for IFI6 Antibody (H00002537-M02)

View related products by pathway.

PTMs for IFI6 Antibody (H00002537-M02)

Learn more about PTMs related to IFI6 Antibody (H00002537-M02).

Blogs on IFI6

There are no specific blogs for IFI6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFI6 Antibody (M2) and receive a gift card or discount.

Bioinformatics

Gene Symbol IFI6
Entrez
OMIM
Uniprot