Recombinant Human IFI35 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IFI35 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 189 - 288 of Human IFI35 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
IFI35

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IFI35 Protein

  • FLJ21753
  • ifi-35
  • IFP 35
  • IFP35interferon-induced 35 kDa protein
  • interferon-induced protein 35

Background

IFI35 - interferon-induced protein 35

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
H00009111-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010538-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF2570
Species: Hu
Applications: WB, IHC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-89345
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-57588
Species: Hu
Applications: WB, ICC/IF
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
H00005956-R02
Species: Hu
NBP1-92569
Species: Hu
Applications: WB, IHC, IHC-P
AF3385
Species: Hu
Applications: WB, IHC
H00003430-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for IFI35 Partial Recombinant Protein (H00003430-Q01) (0)

There are no publications for IFI35 Partial Recombinant Protein (H00003430-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFI35 Partial Recombinant Protein (H00003430-Q01) (0)

There are no reviews for IFI35 Partial Recombinant Protein (H00003430-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFI35 Partial Recombinant Protein (H00003430-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFI35 Products

Bioinformatics Tool for IFI35 Partial Recombinant Protein (H00003430-Q01)

Discover related pathways, diseases and genes to IFI35 Partial Recombinant Protein (H00003430-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFI35 Partial Recombinant Protein (H00003430-Q01)

Discover more about diseases related to IFI35 Partial Recombinant Protein (H00003430-Q01).
 

Pathways for IFI35 Partial Recombinant Protein (H00003430-Q01)

View related products by pathway.

PTMs for IFI35 Partial Recombinant Protein (H00003430-Q01)

Learn more about PTMs related to IFI35 Partial Recombinant Protein (H00003430-Q01).

Blogs on IFI35

There are no specific blogs for IFI35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IFI35 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IFI35