Iduronate 2-Sulfatase/IDS Antibody


Western Blot: Iduronate 2 sulfatase Antibody [NBP1-74126] - Hela cell Lysate, Titration: 1 ug/ml and Gel concentration: 12%

Product Details

Product Discontinued
View other related Iduronate 2-Sulfatase/IDS Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Iduronate 2-Sulfatase/IDS Antibody Summary

Synthetic peptides corresponding to the N terminal of IDS. Immunizing peptide sequence SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IDS and was validated on Western blot.
Positive Control
Iduronate 2-Sulfatase/IDS Lysate (NBP2-66326)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Iduronate 2-Sulfatase/IDS Antibody

  • Alpha-L-iduronate sulfate sulfatase
  • EC
  • IDS
  • iduronate 2-sulfatase 14 kDa chain
  • iduronate 2-sulfatase 42 kDa chain
  • iduronate 2-sulfatase
  • idursulfase
  • MPS2
  • S
  • SIDS


Iduronate-2-sulfatase is required for the lysosomal degradation of heparan sulfate and dermatan sulfate. Mutations in this X-chromosome gene that result in enzymatic deficiency lead to the sex-linked Mucopolysaccharidosis Type II, also known as Hunter Syndrome. Iduronate-2-sulfatase has a strong sequence similarity with human arylsulfatases A, B, and C, and human glucosamine-6-sulfatase. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq, Fe, Pm, Rb
Applications: WB, Simple Western
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC

Publications for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126) (0)

There are no publications for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126) (0)

There are no reviews for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Iduronate 2-Sulfatase/IDS Products

Bioinformatics Tool for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126)

Discover related pathways, diseases and genes to Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126)

Discover more about diseases related to Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126).

Pathways for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126)

View related products by pathway.

PTMs for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126)

Learn more about PTMs related to Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126).

Blogs on Iduronate 2-Sulfatase/IDS

There are no specific blogs for Iduronate 2-Sulfatase/IDS, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Iduronate 2-Sulfatase/IDS Antibody and receive a gift card or discount.


Gene Symbol IDS