Iduronate 2-Sulfatase/IDS Antibody

Images

 
Western Blot: Iduronate 2 sulfatase Antibody [NBP1-74126] - Hela cell Lysate, Titration: 1 ug/ml and Gel concentration: 12%

Product Details

Summary
Product Discontinued
View other related Iduronate 2-Sulfatase/IDS Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74126
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Iduronate 2-Sulfatase/IDS Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of IDS. Immunizing peptide sequence SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE.
Clonality
Polyclonal
Host
Rabbit
Gene
IDS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against IDS and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Iduronate 2-Sulfatase/IDS Antibody

  • Alpha-L-iduronate sulfate sulfatase
  • EC 3.1.6.13
  • IDS
  • iduronate 2-sulfatase 14 kDa chain
  • iduronate 2-sulfatase 42 kDa chain
  • iduronate 2-sulfatase
  • idursulfase
  • MPS2
  • S
  • SIDS

Background

Iduronate-2-sulfatase is required for the lysosomal degradation of heparan sulfate and dermatan sulfate. Mutations in this X-chromosome gene that result in enzymatic deficiency lead to the sex-linked Mucopolysaccharidosis Type II, also known as Hunter Syndrome. Iduronate-2-sulfatase has a strong sequence similarity with human arylsulfatases A, B, and C, and human glucosamine-6-sulfatase. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-79280
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
H00347527-B01P
Species: Hu
Applications: WB, ELISA
NBP1-81872
Species: Hu
Applications: IHC, IHC-P
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5787
Species: Hu, Mu
Applications: WB, IHC, ICC
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-92394
Species: Hu
Applications: IHC, IHC-P
NBP1-62518
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC

Publications for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126) (0)

There are no publications for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126) (0)

There are no reviews for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Iduronate 2-Sulfatase/IDS Products

Bioinformatics Tool for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126)

Discover related pathways, diseases and genes to Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126)

Discover more about diseases related to Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126).
 

Pathways for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126)

View related products by pathway.

PTMs for Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126)

Learn more about PTMs related to Iduronate 2-Sulfatase/IDS Antibody (NBP1-74126).

Blogs on Iduronate 2-Sulfatase/IDS

There are no specific blogs for Iduronate 2-Sulfatase/IDS, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Iduronate 2-Sulfatase/IDS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IDS
Entrez
Uniprot