Recombinant Human Hydrogen Potassium ATPase Beta Protein

Images

 
SDS-Page: Recombinant Human Hydrogen Potassium ATPase Beta Protein [H00000496-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Hydrogen Potassium ATPase Beta Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 67 - 176 of Human ATP4B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATP4B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hydrogen Potassium ATPase Beta Protein

  • ATP6B
  • ATPase, H+/K+ exchanging, beta polypeptide
  • ATPase, H+/K+ transporting, beta polypeptide
  • Gastric H(+)/K(+) ATPase subunit beta
  • gastric H+/K+ ATPase beta subunit
  • gastric hydrogen-potassium ATPase, beta
  • potassium-transporting ATPase beta chain
  • potassium-transporting ATPase subunit beta
  • Proton pump beta chain

Background

The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88889
Species: Hu
Applications: IHC, IHC-P
NBP1-92180
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33870
Species: Hu, Fe
Applications: ICC/IF, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-90312
Species: Hu
Applications: IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NB100-56630
Species: Hu
Applications: WB
H00000496-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Hydrogen Potassium ATPase Beta Partial Recombinant Protein (H00000496-Q01) (0)

There are no publications for Hydrogen Potassium ATPase Beta Partial Recombinant Protein (H00000496-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hydrogen Potassium ATPase Beta Partial Recombinant Protein (H00000496-Q01) (0)

There are no reviews for Hydrogen Potassium ATPase Beta Partial Recombinant Protein (H00000496-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hydrogen Potassium ATPase Beta Partial Recombinant Protein (H00000496-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hydrogen Potassium ATPase Beta Products

Bioinformatics Tool for Hydrogen Potassium ATPase Beta Partial Recombinant Protein (H00000496-Q01)

Discover related pathways, diseases and genes to Hydrogen Potassium ATPase Beta Partial Recombinant Protein (H00000496-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hydrogen Potassium ATPase Beta Partial Recombinant Protein (H00000496-Q01)

Discover more about diseases related to Hydrogen Potassium ATPase Beta Partial Recombinant Protein (H00000496-Q01).
 

Pathways for Hydrogen Potassium ATPase Beta Partial Recombinant Protein (H00000496-Q01)

View related products by pathway.

Blogs on Hydrogen Potassium ATPase Beta

There are no specific blogs for Hydrogen Potassium ATPase Beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Thrombopoietin/Tpo
288-TP-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hydrogen Potassium ATPase Beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP4B