Hydrogen Potassium ATPase Beta Antibody

Western Blot: Hydrogen Potassium ATPase Beta Antibody [H00000496-D01P] - Analysis of ATP4B expression in mouse liver.

Western Blot: Hydrogen Potassium ATPase Beta Antibody [H00000496-D01P] - Analysis of ATP4B expression in human pancreas.

Western Blot: Hydrogen Potassium ATPase Beta Antibody [H00000496-D01P] - Analysis of ATP4B expression in transfected 293T cell line by ATP4B polyclonal antibody.Lane 1: ATP4B transfected lysate(32.12 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

Hydrogen Potassium ATPase Beta Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: ATP4B (AAH29059, 1 a.a. - 291 a.a.) full-length human protein. MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
• Specificity: ATP4B - ATPase, H+/K+ exchanging, beta polypeptide,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP4B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against tissue lysate and transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hydrogen Potassium ATPase Beta Antibody

• ATP4B
• ATP6B
• ATPase, H+/K+ exchanging, beta polypeptide
• ATPase, H+/K+ transporting, beta polypeptide
• Gastric H(+)/K(+) ATPase subunit beta
• gastric H+/K+ ATPase beta subunit
• gastric hydrogen-potassium ATPase, beta
• Hydrogen Potassium ATPase Beta
• potassium-transporting ATPase beta chain
• potassium-transporting ATPase subunit beta
• Proton pump beta chain

Background

The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP4B
• Entrez:
  • 496(Human)
• Uniprot:
  • AAH29059(Human)