Recombinant Human Hyaluronidase 4/HYAL4 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Hyaluronidase 4/HYAL4 Peptides and Proteins

Order Details


    • Catalog Number
      H00023553-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Hyaluronidase 4/HYAL4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 357-456 of Human HYAL4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FVSSDLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGKASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCS

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
HYAL4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hyaluronidase 4/HYAL4 Protein

  • chondroitin sulfate hydrolase
  • CSHY
  • EC 3.2.1
  • EC 3.2.1.35
  • HYAL4
  • Hyal-4
  • Hyaluronidase 4
  • hyaluronidase-4
  • hyaluronoglucosaminidase 4
  • hyaluronoglucosaminidase-4

Background

This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. However, this protein has not yet been shown to have hyaluronidase activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83409
Species: Hu
Applications: IHC, IHC-P
NBP1-81283
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14112
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86328
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51635
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37446
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
H00023553-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01) (0)

There are no publications for Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01) (0)

There are no reviews for Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hyaluronidase 4/HYAL4 Products

Bioinformatics Tool for Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01)

Discover related pathways, diseases and genes to Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01)

Discover more about diseases related to Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01).
 

Pathways for Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01)

View related products by pathway.

PTMs for Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01)

Learn more about PTMs related to Hyaluronidase 4/HYAL4 Partial Recombinant Protein (H00023553-Q01).

Blogs on Hyaluronidase 4/HYAL4

There are no specific blogs for Hyaluronidase 4/HYAL4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hyaluronidase 4/HYAL4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HYAL4
Entrez