Huntingtin Antibody (2E10.) [Alexa Fluor® 700]

Images

 

Product Details

Summary
Product Discontinued
View other related Huntingtin Primary Antibodies

Order Details


    • Catalog Number
      H00003064-M01AF700
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Huntingtin Antibody (2E10.) [Alexa Fluor® 700] Summary

Immunogen
HD (NP_002102, 81 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW
Localization
Cytoplasmic
Specificity
HD - huntingtin (Huntington disease)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HTT
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Alexa Flour (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research.

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for Huntingtin Antibody (2E10.) [Alexa Fluor® 700]

  • HD protein
  • huntingtin (Huntington disease)
  • huntingtin
  • IT15HDHuntington disease protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7665
Species: Hu
Applications: WB, IHC
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Huntingtin Antibody (H00003064-M01AF700) (0)

There are no publications for Huntingtin Antibody (H00003064-M01AF700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Huntingtin Antibody (H00003064-M01AF700) (0)

There are no reviews for Huntingtin Antibody (H00003064-M01AF700). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Huntingtin Antibody (H00003064-M01AF700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Huntingtin Products

Related Products by Gene

Bioinformatics Tool for Huntingtin Antibody (H00003064-M01AF700)

Discover related pathways, diseases and genes to Huntingtin Antibody (H00003064-M01AF700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Huntingtin Antibody (H00003064-M01AF700)

Discover more about diseases related to Huntingtin Antibody (H00003064-M01AF700).
 

Pathways for Huntingtin Antibody (H00003064-M01AF700)

View related products by pathway.

PTMs for Huntingtin Antibody (H00003064-M01AF700)

Learn more about PTMs related to Huntingtin Antibody (H00003064-M01AF700).
 

Research Areas for Huntingtin Antibody (H00003064-M01AF700)

Find related products by research area.

Blogs on Huntingtin

There are no specific blogs for Huntingtin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Huntingtin Antibody (2E10.) [Alexa Fluor® 700] and receive a gift card or discount.

Bioinformatics

Gene Symbol HTT