Huntingtin Antibody (1C10)

Images

 
Immunocytochemistry/ Immunofluorescence: Huntingtin Antibody (1C10) [H00003064-M20] - Analysis of monoclonal antibody to HTT on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Huntingtin Antibody (1C10) Summary

Immunogen
HD (NP_002102 1524 a.a. - 1627 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDS
Specificity
HD (1C10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HTT
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Huntingtin Antibody (1C10)

  • HD protein
  • huntingtin (Huntington disease)
  • huntingtin
  • IT15HDHuntington disease protein

Background

Huntingtin is a disease gene linked to Huntington's disease, a neurodegenerative disorder characterized by loss of striatal neurons. This is thought to be caused by an expanded, unstable trinucleotide repeat in the huntingtin gene, which translates as a polyglutamine repeat in the protein product. A fairly broad range in the number of trinucleotide repeats has been identified in normal controls, and repeat numbers in excess of 40 have been described as pathological. The huntingtin locus is large, spanning 180 kb and consisting of 67 exons. The huntingtin gene is widely expressed and is required for normal development. It is expressed as 2 alternatively polyadenylated forms displaying different relative abundance in various fetal and adult tissues. The larger transcript is approximately 13.7 kb and is expressed predominantly in adult and fetal brain whereas the smaller transcript of approximately 10.3 kb is more widely expressed. The genetic defect leading to Huntington's disease may not necessarily eliminate transcription, but may confer a new property on the mRNA or alter the function of the protein. One candidate is the huntingtin-associated protein-1, highly expressed in brain, which has increased affinity for huntingtin protein with expanded polyglutamine repeats. This gene contains an upstream open reading frame in the 5' UTR that inhibits expression of the huntingtin gene product through translational repression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
9134-TN
Species: Hu

Publications for Huntingtin Antibody (H00003064-M20) (0)

There are no publications for Huntingtin Antibody (H00003064-M20).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Huntingtin Antibody (H00003064-M20) (0)

There are no reviews for Huntingtin Antibody (H00003064-M20). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Huntingtin Antibody (H00003064-M20) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Huntingtin Products

Bioinformatics Tool for Huntingtin Antibody (H00003064-M20)

Discover related pathways, diseases and genes to Huntingtin Antibody (H00003064-M20). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Huntingtin Antibody (H00003064-M20)

Discover more about diseases related to Huntingtin Antibody (H00003064-M20).
 

Pathways for Huntingtin Antibody (H00003064-M20)

View related products by pathway.

PTMs for Huntingtin Antibody (H00003064-M20)

Learn more about PTMs related to Huntingtin Antibody (H00003064-M20).
 

Research Areas for Huntingtin Antibody (H00003064-M20)

Find related products by research area.

Blogs on Huntingtin

There are no specific blogs for Huntingtin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Huntingtin Antibody (1C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol HTT
Entrez
OMIM
Uniprot