Human Growth Hormone Recombinant Protein

Images

 
SDS-Page: Human Growth Hormone Protein [NBC1-18450] - Growth hormone, 22.2 kDa (192 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE

Product Details

Summary
Applications PAGE
Concentration
1.0 mg/ml

Order Details

Human Growth Hormone Recombinant Protein Summary

Description
A recombinant protein corresponding to GH1.

Amino Acid Sequence: MFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Preparation
Method
E.coli
Details of Functionality
The proliferative activity of rhGH was tested in culture using rat Nb2 Lymphoma cells
Gene
GH1
Purity
>95% pure by SDS-PAGE
Endotoxin Note
< 1.0 EU per 1 microgram of protein (determined by LAL method)

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
Liquid. In. 88mM mannitol, 5mM phosphate, pH 7.4
Preservative
No Preservative
Concentration
1.0 mg/ml
Purity
>95% pure by SDS-PAGE

Reactivity Notes

Human.

Notes

The purity of this protein is > 95% by SDS-PAGE. Molecular weight is 22.2 kDa (192 aa), confirmed by MALDI-TOF. This protein has been reported to have proliferation activity in rat lymphoma cells.

Alternate Names for Human Growth Hormone Recombinant Protein

  • GHIGHD1B
  • GHNGrowth hormone
  • GH-Nsomatotropin
  • growth hormone 1Pituitary growth hormone
  • hGH-N

Background

Human growth hormone(hGH, somatotropin), a protein hormone from the anterior lobe of the pituitary gland, comprises a single polypeptide chain of 191 amino acid residues. The growth hormone amino acid sequence varies considerably between species, and non-primate growth hormones have little activity in man. Its main function is the stimulation of somatic and bone growth, as well as an increase in the size and mass of organs and tissues. Recombinant human growth hormone(rhGH ) was purified by FPLC gel-filtration chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87022
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-31885
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF1210
Species: Hu
Applications: WB, Flow, IHC, Neut
MAB8200
Species: Hu, Mu
Applications: IHC
MAB1249
Species: Hu, Mu
Applications: ICC, ICFlow
MAB675
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00000292-B01P
Species: Hu
Applications: WB, ELISA
NBP1-92273
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Human Growth Hormone Protein (NBC1-18450) (0)

There are no publications for Human Growth Hormone Protein (NBC1-18450).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Human Growth Hormone Protein (NBC1-18450) (0)

There are no reviews for Human Growth Hormone Protein (NBC1-18450). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for Human Growth Hormone Protein (NBC1-18450) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Human Growth Hormone Products

Related Products by Gene

Bioinformatics Tool for Human Growth Hormone Protein (NBC1-18450)

Discover related pathways, diseases and genes to Human Growth Hormone Protein (NBC1-18450). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Human Growth Hormone Protein (NBC1-18450)

Discover more about diseases related to Human Growth Hormone Protein (NBC1-18450).
 

Pathways for Human Growth Hormone Protein (NBC1-18450)

View related products by pathway.

PTMs for Human Growth Hormone Protein (NBC1-18450)

Learn more about PTMs related to Human Growth Hormone Protein (NBC1-18450).

Blogs on Human Growth Hormone

There are no specific blogs for Human Growth Hormone, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol GH1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBC1-18450 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

POMC Antibody
NB100-1533
POMC Antibody
NB100-1533
POMC Antibody
NB100-1533