HUCE1 Antibody - Azide and BSA Free

Western Blot: HUCE1 Antibody [NBP3-16047] - Western blot analysis of extracts of various cell lines, using HUCE1 antibody (NBP3-16047) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HUCE1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit HUCE1 Antibody - Azide and BSA Free (NBP3-16047) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HUCE1 (NP_056139.1). GPPCSDSEEEVERKKKCHKQALVGSDSAEDEKRKRKCQKHAPINSAQHLDNVDQTGPKAWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RRP8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for HUCE1 Antibody - Azide and BSA Free

• Cerebral protein 1
• KIAA0409EC 2.1.1.-
• NML
• nucleomethylin
• ribosomal RNA processing 8, methyltransferase, homolog (yeast)
• ribosomal RNA-processing protein 8
• RRP8 methyltransferase homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RRP8