HSPH1/HSP105 Antibody

Images

 
Western Blot: HSPH1/HSP105 Antibody [NBP1-53126] - Sample Type: Human MCF7 Antibody Dilution: 1.0 ug/ml HSPH1 is strongly supported by BioGPS gene expression data to be expressed in MCF7
Immunohistochemistry: HSPH1/HSP105 Antibody [NBP1-53126] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in endothelial cells in sinusoids Primary Antibody Concentration: 1:100 ...read more
Western Blot: HSPH1/HSP105 Antibody [NBP1-53126] - Human 721_B, Antibody Dilution: 1.0 ug/ml HSPH1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: HSPH1/HSP105 Antibody [NBP1-53126] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml
Western Blot: HSPH1/HSP105 Antibody [NBP1-53126] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: 293T cell lysate

Product Details

Summary
Product Discontinued
View other related HSPH1/HSP105 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53126
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HSPH1/HSP105 Antibody Summary

Immunogen
Synthetic peptides corresponding to HSPH1(heat shock 105kDa/110kDa protein 1) The peptide sequence was selected from the middle region of HSPH1. Peptide sequence EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ.
Clonality
Polyclonal
Host
Rabbit
Gene
HSPH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against HSPH1 and was validated on Western blot.
Theoretical MW
97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HSPH1/HSP105 Antibody

  • Antigen NY-CO-25
  • heat shock 105kD beta
  • heat shock 105kDa protein 1
  • heat shock 105kDa/110kDa protein 1
  • Heat shock 110 kDa protein
  • heat shock protein 105 kDa
  • HSP105a
  • HSP105B
  • HSP105heat shock 105kD alpha
  • HSP110
  • HSPH1
  • KIAA0201DKFZp686M05240
  • NY-CO-25

Background

HSPH1 prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. It inhibits HSPA8/HSC70 ATPase and chaperone activities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-48700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14113
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for HSPH1/HSP105 Antibody (NBP1-53126) (0)

There are no publications for HSPH1/HSP105 Antibody (NBP1-53126).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSPH1/HSP105 Antibody (NBP1-53126) (0)

There are no reviews for HSPH1/HSP105 Antibody (NBP1-53126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSPH1/HSP105 Antibody (NBP1-53126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSPH1/HSP105 Products

Bioinformatics Tool for HSPH1/HSP105 Antibody (NBP1-53126)

Discover related pathways, diseases and genes to HSPH1/HSP105 Antibody (NBP1-53126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSPH1/HSP105 Antibody (NBP1-53126)

Discover more about diseases related to HSPH1/HSP105 Antibody (NBP1-53126).
 

Pathways for HSPH1/HSP105 Antibody (NBP1-53126)

View related products by pathway.

PTMs for HSPH1/HSP105 Antibody (NBP1-53126)

Learn more about PTMs related to HSPH1/HSP105 Antibody (NBP1-53126).

Blogs on HSPH1/HSP105

There are no specific blogs for HSPH1/HSP105, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSPH1/HSP105 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPH1
Entrez
Uniprot