HSPB8/HSP22 Antibody


Western Blot: HSPB8/HSP22 Antibody [NBP1-54395] - Titration: 0.2-1 ug/ml, Positive Control: ACHN cell lysate.

Product Details

Product Discontinued
View other related HSPB8/HSP22 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HSPB8/HSP22 Antibody Summary

Synthetic peptides corresponding to HSPB8 (heat shock 22kDa protein 8) The peptide sequence was selected from the middle region of HSPB8. Peptide sequence PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HSPB8 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HSPB8/HSP22 Antibody

  • Alpha-crystallin C chain
  • CMT2L
  • DHMN2
  • E2IG1
  • E2IG1E2-induced gene 1 protein
  • H11
  • H11DHMN2
  • heat shock 22kDa protein 8
  • heat shock 27kDa protein 8
  • heat shock protein beta-8
  • HMN2
  • HMN2A
  • HSP22
  • HSP22CMT2L
  • HSPB8
  • Protein kinase H11
  • Small stress protein-like protein HSP22


HSPB8 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of HSPB8 protein is induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, HSPB8 appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in the encoding HSPB8 gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
Species: Mu
Applications: WB, Simple Western
Species: Hu
Applications: WB

Publications for HSPB8/HSP22 Antibody (NBP1-54395) (0)

There are no publications for HSPB8/HSP22 Antibody (NBP1-54395).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSPB8/HSP22 Antibody (NBP1-54395) (0)

There are no reviews for HSPB8/HSP22 Antibody (NBP1-54395). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSPB8/HSP22 Antibody (NBP1-54395) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for HSPB8/HSP22 Antibody (NBP1-54395)

Discover related pathways, diseases and genes to HSPB8/HSP22 Antibody (NBP1-54395). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSPB8/HSP22 Antibody (NBP1-54395)

Discover more about diseases related to HSPB8/HSP22 Antibody (NBP1-54395).

Pathways for HSPB8/HSP22 Antibody (NBP1-54395)

View related products by pathway.

PTMs for HSPB8/HSP22 Antibody (NBP1-54395)

Learn more about PTMs related to HSPB8/HSP22 Antibody (NBP1-54395).

Research Areas for HSPB8/HSP22 Antibody (NBP1-54395)

Find related products by research area.

Blogs on HSPB8/HSP22

There are no specific blogs for HSPB8/HSP22, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HSPB8/HSP22 Antibody and receive a gift card or discount.


Gene Symbol HSPB8