HSP90 Antibody

Images

 
Western Blot: Hsp90 Antibody [NBP1-98318] - Mouse Brain Lysate 1.0ug/ml, Gel Concentration: 12%

Product Details

Summary
Product Discontinued
View other related HSP90 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-98318
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HSP90 Antibody Summary

Immunogen
The immunogen for this antibody is Hsp90 - C-terminal region. Peptide sequence: STMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALL
Clonality
Polyclonal
Host
Rabbit
Gene
HSP90AA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:1000

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HSP90 Antibody

  • FLJ31884
  • Heat shock 86 kDa
  • heat shock 90kD protein 1, alpha
  • heat shock 90kD protein 1, alpha-like 4
  • heat shock 90kD protein, alpha-like 4
  • heat shock 90kDa protein 1, alpha
  • heat shock protein 90kDa alpha (cytosolic), class A member 1
  • heat shock protein HSP 90-alpha
  • Hsp89
  • HSP90
  • HSP90AHSP86
  • HSP90N
  • HSPC1HSP 86
  • HSPCAHSP89A
  • HSPCAL1
  • HSPCAL4
  • HSPN
  • LAP2
  • Renal carcinoma antigen NY-REN-38

Background

Hsp90aa1 is a molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Hsp90aa1 undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Hsp90aa1 interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye, Am(-), Av(-), Pm(-)
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB2055
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, ICFlow
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
MAB23141
Species: Hu
Applications: WB, ICC
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
MAB9028
Species: Hu
Applications: WB
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
AF7250
Species: Hu
Applications: IHC
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-98318
Species: Mu
Applications: WB

Publications for HSP90 Antibody (NBP1-98318) (0)

There are no publications for HSP90 Antibody (NBP1-98318).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP90 Antibody (NBP1-98318) (0)

There are no reviews for HSP90 Antibody (NBP1-98318). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSP90 Antibody (NBP1-98318) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSP90 Antibody Products

HSP90 NBP1-98318

Related Products by Gene

Bioinformatics Tool for HSP90 Antibody (NBP1-98318)

Discover related pathways, diseases and genes to HSP90 Antibody (NBP1-98318). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSP90 Antibody (NBP1-98318)

Discover more about diseases related to HSP90 Antibody (NBP1-98318).
 

Pathways for HSP90 Antibody (NBP1-98318)

View related products by pathway.

PTMs for HSP90 Antibody (NBP1-98318)

Learn more about PTMs related to HSP90 Antibody (NBP1-98318).

Blogs on HSP90.

HSP90 - an essential eukaryotic protein with implications for drug development
The heat-shock protein 90 (HSP90) family is a group of highly conserved molecular chaperones with important functions in protein folding and in signal transduction. The HSP90 protein structure is so well conserved that some HSP90 antibodies are rea...  Read full blog post.

Integrin beta 1 binding protein 2
ITGB1BP2 is a muscle-specific protein cloned by a rat created by Branccio's group in Italy that was found to interact with the cytoplasmic domain of integrin beta 11. It is expressed only in heart and skeletal muscle but is not essential for normal de...  Read full blog post.

HSP Antibodies: Novel Therapies for MMP-induced Metastatic Breast Cancer
The matrix metalloproteinases are zinc-dependent protease enzymes which interact with a range of ECM (extracellular matrix) proteins, and are activated by proteolytic cleavage. We at Novus Biologicals offer a wide range of top quality MMP reagents, in...  Read full blog post.

Heat Shock Proteins: An Overview
Heat Shock Proteins (HSPs) are a ubiquitous group of molecular chaperone proteins that have evolved unique mechanisms, within their host cells, to facilitate survival in hostile environments such as heat, oxidative (hypoxia), pH and cold. Under permis...  Read full blog post.

The Heat is On: Heat Shock Proteins and the Link to Cancer
Novus Biologicals offers an extensive antibody catalog targeting heat shock proteins (HSPs). A large protein group covering a number of families, the HSPs are functionally related by their dramatic upregulation in response to stress. Stress triggers m...  Read full blog post.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol HSP90AA1
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-98318 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.