HSP90 Antibody


Western Blot: Hsp90 Antibody [NBP1-98318] - Mouse Brain Lysate 1.0ug/ml, Gel Concentration: 12%

Product Details

Product Discontinued
View other related HSP90 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HSP90 Antibody Summary

The immunogen for this antibody is Hsp90 - C-terminal region. Peptide sequence: STMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALL
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HSP90 Antibody

  • FLJ31884
  • Heat shock 86 kDa
  • heat shock 90kD protein 1, alpha
  • heat shock 90kD protein 1, alpha-like 4
  • heat shock 90kD protein, alpha-like 4
  • heat shock 90kDa protein 1, alpha
  • heat shock protein 90kDa alpha (cytosolic), class A member 1
  • heat shock protein HSP 90-alpha
  • Hsp89
  • HSP90
  • HSP90AHSP86
  • HSP90N
  • HSPC1HSP 86
  • HSPN
  • LAP2
  • Renal carcinoma antigen NY-REN-38


Hsp90aa1 is a molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Hsp90aa1 undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Hsp90aa1 interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB

Publications for HSP90 Antibody (NBP1-98318) (0)

There are no publications for HSP90 Antibody (NBP1-98318).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP90 Antibody (NBP1-98318) (0)

There are no reviews for HSP90 Antibody (NBP1-98318). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSP90 Antibody (NBP1-98318) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HSP90 Antibody Products

Related Products by Gene

Bioinformatics Tool for HSP90 Antibody (NBP1-98318)

Discover related pathways, diseases and genes to HSP90 Antibody (NBP1-98318). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSP90 Antibody (NBP1-98318)

Discover more about diseases related to HSP90 Antibody (NBP1-98318).

Pathways for HSP90 Antibody (NBP1-98318)

View related products by pathway.

PTMs for HSP90 Antibody (NBP1-98318)

Learn more about PTMs related to HSP90 Antibody (NBP1-98318).

Blogs on HSP90.

HSP90 - an essential eukaryotic protein with implications for drug development
The heat-shock protein 90 (HSP90) family is a group of highly conserved molecular chaperones with important functions in protein folding and in signal transduction. The HSP90 protein structure is so well conserved that some HSP90 antibodies are rea...  Read full blog post.

Integrin beta 1 binding protein 2
ITGB1BP2 is a muscle-specific protein cloned by a rat created by Branccio's group in Italy that was found to interact with the cytoplasmic domain of integrin beta 11. It is expressed only in heart and skeletal muscle but is not essential for normal de...  Read full blog post.

HSP Antibodies: Novel Therapies for MMP-induced Metastatic Breast Cancer
The matrix metalloproteinases are zinc-dependent protease enzymes which interact with a range of ECM (extracellular matrix) proteins, and are activated by proteolytic cleavage. We at Novus Biologicals offer a wide range of top quality MMP reagents, in...  Read full blog post.

Heat Shock Proteins: An Overview
Heat Shock Proteins (HSPs) are a ubiquitous group of molecular chaperone proteins that have evolved unique mechanisms, within their host cells, to facilitate survival in hostile environments such as heat, oxidative (hypoxia), pH and cold. Under permis...  Read full blog post.

The Heat is On: Heat Shock Proteins and the Link to Cancer
Novus Biologicals offers an extensive antibody catalog targeting heat shock proteins (HSPs). A large protein group covering a number of families, the HSPs are functionally related by their dramatic upregulation in response to stress. Stress triggers m...  Read full blog post.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HSP90 Antibody and receive a gift card or discount.


Gene Symbol HSP90AA1