Hsp47 Recombinant Protein Antigen

Images

 
There are currently no images for Hsp47 Protein (NBP1-88172PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Hsp47 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERPINH1.

Source: E. coli

Amino Acid Sequence: LSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SERPINH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88172.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hsp47 Recombinant Protein Antigen

  • (collagen binding protein 1)
  • Arsenic-transactivated protein 3
  • AsTP3
  • BERF-1
  • CBP1
  • CBP2
  • CBP2RA-A47
  • Cell proliferation-inducing gene 14 protein
  • Collagen-binding protein
  • colligen
  • Colligin
  • colligin-1
  • colligin-2
  • gp46
  • HSP47
  • HSP47serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47)
  • member 1, (collagen binding protein 1)
  • member 2
  • member 2, (collagen-binding protein 2)
  • OI10
  • PPROM
  • proliferation-inducing gene 14
  • RA-A47
  • rheumatoid arthritis antigen A-47,47 kDa heat shock protein
  • Rheumatoid arthritis-related antigen RA-A47
  • serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47)
  • Serpin H1
  • serpin peptidase inhibitor, clade H (heat shock protein 47), member 1
  • SERPINH1
  • SERPINH2colligin

Background

Hsp47 encodes a member of the serpin superfamily of serine proteinase inhibitors. Its expression is induced by heat shock. The protein localizes to the endoplasmic reticulum lumen and binds collagen; thus it is thought to be a molecular chaperone involved in the maturation of collagen molecules. Autoantibodies to this protein have been found in patients with rheumatoid arthritis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

M6000B
Species: Mu
Applications: ELISA
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-11884
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, RIA, WB
1290-IL
Species: Hu
Applications: BA
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-92790
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-88172PEP
Species: Hu
Applications: AC

Publications for Hsp47 Protein (NBP1-88172PEP) (0)

There are no publications for Hsp47 Protein (NBP1-88172PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hsp47 Protein (NBP1-88172PEP) (0)

There are no reviews for Hsp47 Protein (NBP1-88172PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hsp47 Protein (NBP1-88172PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hsp47 Products

Research Areas for Hsp47 Protein (NBP1-88172PEP)

Find related products by research area.

Blogs on Hsp47

There are no specific blogs for Hsp47, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Hsp47 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINH1