HSP40/DNAJB1 Antibody

Images

 
Western Blot: HSP40/DNAJB1 Antibody [NBP1-56645] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: HSP40/DNAJB1 Antibody [NBP1-56645] - Human Lung Tissue Observed Staining: Nucleus of pneumocytes Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary ...read more

Product Details

Summary
Product Discontinued
View other related HSP40/DNAJB1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56645
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HSP40/DNAJB1 Antibody Summary

Immunogen
Synthetic peptides corresponding to DNAJB1(DnaJ (Hsp40) homolog, subfamily B, member 1) The peptide sequence was selected from the N terminal of DNAJB1. Peptide sequence GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE.
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against DNAJB1 and was validated on Western blot.
Positive Control
HSP40/DNAJB1 Lysate (NBP2-65689)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HSP40/DNAJB1 Antibody

  • DnaJ (Hsp40) homolog, subfamily B, member 1
  • DnaJ (Hsp40) homolog, subfmaily B, member 1
  • dnaJ homolog subfamily B member 1
  • DnaJ protein homolog 1
  • DNAJ1
  • DNAJB1
  • Hdj1
  • hDj-1
  • Heat shock 40 kDa protein 1
  • heat shock 40kD protein 1
  • Heat shock protein 40
  • HSP40
  • HSPF1
  • HSPF1Hdj1
  • Human DnaJ protein 1
  • radial spoke 16 homolog B
  • RSPH16B
  • Sis1

Background

DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88019
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-61615
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
MAB7357
Species: Hu
Applications: WB
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-67822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP

Publications for HSP40/DNAJB1 Antibody (NBP1-56645) (0)

There are no publications for HSP40/DNAJB1 Antibody (NBP1-56645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP40/DNAJB1 Antibody (NBP1-56645) (0)

There are no reviews for HSP40/DNAJB1 Antibody (NBP1-56645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSP40/DNAJB1 Antibody (NBP1-56645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HSP40/DNAJB1 Antibody (NBP1-56645)

Discover related pathways, diseases and genes to HSP40/DNAJB1 Antibody (NBP1-56645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSP40/DNAJB1 Antibody (NBP1-56645)

Discover more about diseases related to HSP40/DNAJB1 Antibody (NBP1-56645).
 

Pathways for HSP40/DNAJB1 Antibody (NBP1-56645)

View related products by pathway.

PTMs for HSP40/DNAJB1 Antibody (NBP1-56645)

Learn more about PTMs related to HSP40/DNAJB1 Antibody (NBP1-56645).
 

Research Areas for HSP40/DNAJB1 Antibody (NBP1-56645)

Find related products by research area.

Blogs on HSP40/DNAJB1

There are no specific blogs for HSP40/DNAJB1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSP40/DNAJB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJB1
Entrez
Uniprot