HSP10/EPF Antibody (4C11-B11) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related HSP10/EPF Primary Antibodies

Order Details


    • Catalog Number
      H00003336-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HSP10/EPF Antibody (4C11-B11) [PE] Summary

Immunogen
HSPE1 (AAH23518, 1 a.a. - 102 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Specificity
HSPE1 - heat shock 10kDa protein 1 (chaperonin 10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HSPE1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSP10/EPF Antibody (4C11-B11) [PE]

  • 10 kDa chaperonin
  • 10 kDa heat shock protein, mitochondrial
  • Chaperonin 10 Homolog
  • Chaperonin 10
  • CPN10HSP10
  • Early-pregnancy factor
  • EPF
  • GroES
  • heat shock 10kD protein 1 (chaperonin 10)
  • heat shock 10kDa protein 1 (chaperonin 10)
  • HSP10
  • HSPE1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-87148
Species: Hu
Applications: WB, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-89557
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-24479
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
H00003336-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HSP10/EPF Antibody (H00003336-M01PE) (0)

There are no publications for HSP10/EPF Antibody (H00003336-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP10/EPF Antibody (H00003336-M01PE) (0)

There are no reviews for HSP10/EPF Antibody (H00003336-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSP10/EPF Antibody (H00003336-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSP10/EPF Products

Bioinformatics Tool for HSP10/EPF Antibody (H00003336-M01PE)

Discover related pathways, diseases and genes to HSP10/EPF Antibody (H00003336-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSP10/EPF Antibody (H00003336-M01PE)

Discover more about diseases related to HSP10/EPF Antibody (H00003336-M01PE).
 

Pathways for HSP10/EPF Antibody (H00003336-M01PE)

View related products by pathway.

Research Areas for HSP10/EPF Antibody (H00003336-M01PE)

Find related products by research area.

Blogs on HSP10/EPF

There are no specific blogs for HSP10/EPF, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSP10/EPF Antibody (4C11-B11) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPE1
Entrez