HSF2 Antibody (1F11-A3) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related HSF2 Primary Antibodies

Order Details


    • Catalog Number
      H00003298-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HSF2 Antibody (1F11-A3) [PerCP] Summary

Immunogen
HSF2 (AAH05329, 1 a.a. - 230 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF
Localization
Cytoplasmic during normal growth and moves to the nucleus upon activation.
Specificity
HSF2 - heat shock transcription factor 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HSF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSF2 Antibody (1F11-A3) [PerCP]

  • heat shock factor 2
  • heat shock factor protein 2
  • heat shock transcription factor 2MGC75048
  • HSF 2
  • HSF2
  • HSTF 2
  • HSTF2
  • MGC117376
  • MGC156196

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB5695
Species: Hu, Mu
Applications: WB
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
H00008630-P01
Species: Hu
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
H00003298-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HSF2 Antibody (H00003298-M01PCP) (0)

There are no publications for HSF2 Antibody (H00003298-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSF2 Antibody (H00003298-M01PCP) (0)

There are no reviews for HSF2 Antibody (H00003298-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSF2 Antibody (H00003298-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSF2 Products

Bioinformatics Tool for HSF2 Antibody (H00003298-M01PCP)

Discover related pathways, diseases and genes to HSF2 Antibody (H00003298-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSF2 Antibody (H00003298-M01PCP)

Discover more about diseases related to HSF2 Antibody (H00003298-M01PCP).
 

Pathways for HSF2 Antibody (H00003298-M01PCP)

View related products by pathway.

PTMs for HSF2 Antibody (H00003298-M01PCP)

Learn more about PTMs related to HSF2 Antibody (H00003298-M01PCP).

Blogs on HSF2

There are no specific blogs for HSF2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSF2 Antibody (1F11-A3) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol HSF2
Entrez