HPS3 Antibody


Western Blot: HPS3 Antibody [NBP1-69075] - Rat Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related HPS3 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HPS3 Antibody Summary

Synthetic peptides corresponding to Hps3 (Hermansky-Pudlak syndrome 3 homolog (human)) The peptide sequence was selected from the N terminal of Hps3. Peptide sequence LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Hps3 and was validated on Western blot.
Theoretical MW
113 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HPS3 Antibody

  • DKFZp686F0413
  • FLJ22704
  • Hermansky-Pudlak syndrome 3 protein
  • Hermansky-Pudlak syndrome 3


The function of Hps3 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for HPS3 Antibody (NBP1-69075) (0)

There are no publications for HPS3 Antibody (NBP1-69075).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HPS3 Antibody (NBP1-69075) (0)

There are no reviews for HPS3 Antibody (NBP1-69075). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HPS3 Antibody (NBP1-69075) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HPS3 Products

Bioinformatics Tool for HPS3 Antibody (NBP1-69075)

Discover related pathways, diseases and genes to HPS3 Antibody (NBP1-69075). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPS3 Antibody (NBP1-69075)

Discover more about diseases related to HPS3 Antibody (NBP1-69075).

Pathways for HPS3 Antibody (NBP1-69075)

View related products by pathway.

PTMs for HPS3 Antibody (NBP1-69075)

Learn more about PTMs related to HPS3 Antibody (NBP1-69075).

Blogs on HPS3

There are no specific blogs for HPS3, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HPS3 Antibody and receive a gift card or discount.


Gene Symbol HPS3