HPGD Antibody (NBP1-87062)

Images

 
Western Blot: HPGD Antibody [NBP1-87062] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: HPGD Antibody [NBP1-87062] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HPGD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPGD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
HPGD Protein (NBP1-87062PEP)
Publications
Read Publications using NBP1-87062.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23390522)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HPGD Antibody

  • hydroxyprostaglandin dehydrogenase 15-(NAD)
  • NAD+-dependent 15-hydroxyprostaglandin dehydrogenase
  • Prostaglandin dehydrogenase 1
  • SDR36C1
  • Short Chain Dehydrogenase/Reductase Family 36C
  • short chain dehydrogenase/reductase family 36C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86595
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00006578-Q01
Species: Hu
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-87892
Species: Hu
Applications: IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for HPGD Antibody (NBP1-87062)(2)

Reviews for HPGD Antibody (NBP1-87062) (0)

There are no reviews for HPGD Antibody (NBP1-87062). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HPGD Antibody (NBP1-87062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPGD Products

HPGD NBP1-87062

Related Products by Gene

Bioinformatics Tool for HPGD Antibody (NBP1-87062)

Discover related pathways, diseases and genes to HPGD Antibody (NBP1-87062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPGD Antibody (NBP1-87062)

Discover more about diseases related to HPGD Antibody (NBP1-87062).
 

Pathways for HPGD Antibody (NBP1-87062)

View related products by pathway.

PTMs for HPGD Antibody (NBP1-87062)

Learn more about PTMs related to HPGD Antibody (NBP1-87062).

Blogs on HPGD

There are no specific blogs for HPGD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPGD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPGD