HPGD Antibody

Images

 
Western Blot: HPGD Antibody [NBP1-87062] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: HPGD Antibody [NBP1-87062] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & cytoplasm.
Immunohistochemistry-Paraffin: HPGD Antibody [NBP1-87062] - Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

HPGD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPGD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
HPGD Protein (NBP1-87062PEP)
Publications
Read Publications using NBP1-87062.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23390522)

Alternate Names for HPGD Antibody

  • hydroxyprostaglandin dehydrogenase 15-(NAD)
  • NAD+-dependent 15-hydroxyprostaglandin dehydrogenase
  • Prostaglandin dehydrogenase 1
  • SDR36C1
  • Short Chain Dehydrogenase/Reductase Family 36C
  • short chain dehydrogenase/reductase family 36C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86595
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13349
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85479
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-87892
Species: Hu
Applications: IHC, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NB120-2765
Species: Hu, Mu, Rt, Bv, Ch, GP, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for HPGD Antibody (NBP1-87062)(2)

Reviews for HPGD Antibody (NBP1-87062) (0)

There are no reviews for HPGD Antibody (NBP1-87062). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HPGD Antibody (NBP1-87062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPGD Antibody Products

HPGD NBP1-87062

Related Products by Gene

Bioinformatics Tool for HPGD Antibody (NBP1-87062)

Discover related pathways, diseases and genes to HPGD Antibody (NBP1-87062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPGD Antibody (NBP1-87062)

Discover more about diseases related to HPGD Antibody (NBP1-87062).
 

Pathways for HPGD Antibody (NBP1-87062)

View related products by pathway.

PTMs for HPGD Antibody (NBP1-87062)

Learn more about PTMs related to HPGD Antibody (NBP1-87062).

Blogs on HPGD

There are no specific blogs for HPGD, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol HPGD

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-87062 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought