HPGD Antibody

Images

 
Western Blot: HPGD Antibody [NBP1-87061] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: HPGD Antibody [NBP1-87061] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: HPGD Antibody [NBP1-87061] - Staining of human urinary bladder shows strong cytoplasmic and nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HPGD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPGD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HPGD Protein (NBP1-87061PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HPGD Antibody

  • hydroxyprostaglandin dehydrogenase 15-(NAD)
  • NAD+-dependent 15-hydroxyprostaglandin dehydrogenase
  • Prostaglandin dehydrogenase 1
  • SDR36C1
  • Short Chain Dehydrogenase/Reductase Family 36C
  • short chain dehydrogenase/reductase family 36C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86595
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBL1-16205
Species: Hu
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-87892
Species: Hu
Applications: IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-87061
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HPGD Antibody (NBP1-87061) (0)

There are no publications for HPGD Antibody (NBP1-87061).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HPGD Antibody (NBP1-87061) (0)

There are no reviews for HPGD Antibody (NBP1-87061). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HPGD Antibody (NBP1-87061) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPGD Products

HPGD NBP1-87061

Bioinformatics Tool for HPGD Antibody (NBP1-87061)

Discover related pathways, diseases and genes to HPGD Antibody (NBP1-87061). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPGD Antibody (NBP1-87061)

Discover more about diseases related to HPGD Antibody (NBP1-87061).
 

Pathways for HPGD Antibody (NBP1-87061)

View related products by pathway.

PTMs for HPGD Antibody (NBP1-87061)

Learn more about PTMs related to HPGD Antibody (NBP1-87061).

Blogs on HPGD

There are no specific blogs for HPGD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPGD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPGD