HOXD8 Antibody (5E11.)


Western Blot: HOXD8 Antibody (5E11) [H00003234-M03] - Analysis of HOXD8 expression in HepG2 (Cat # L019V1).

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

HOXD8 Antibody (5E11.) Summary

HOXD8 (NP_062458 126 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR
HOXD8 - homeobox D8 (5E11)
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXD8 Antibody (5E11.)

  • homeo box 4E
  • homeo box D8
  • homeobox D8
  • homeobox protein 5.4
  • Homeobox protein Hox-4E
  • Homeobox protein Hox-5.4
  • homeobox protein Hox-D8
  • HOX4
  • HOX4EHox-4.5
  • HOX5.4


This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for HOXD8 Antibody (H00003234-M03) (0)

There are no publications for HOXD8 Antibody (H00003234-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXD8 Antibody (H00003234-M03) (0)

There are no reviews for HOXD8 Antibody (H00003234-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXD8 Antibody (H00003234-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HOXD8 Products

Bioinformatics Tool for HOXD8 Antibody (H00003234-M03)

Discover related pathways, diseases and genes to HOXD8 Antibody (H00003234-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXD8 Antibody (H00003234-M03)

Discover more about diseases related to HOXD8 Antibody (H00003234-M03).

Pathways for HOXD8 Antibody (H00003234-M03)

View related products by pathway.

PTMs for HOXD8 Antibody (H00003234-M03)

Learn more about PTMs related to HOXD8 Antibody (H00003234-M03).

Blogs on HOXD8

There are no specific blogs for HOXD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HOXD8 Antibody (5E11.) and receive a gift card or discount.


Gene Symbol HOXD8