HOXD8 Antibody (5E11.)

Images

 
Western Blot: HOXD8 Antibody (5E11) [H00003234-M03] - Analysis of HOXD8 expression in HepG2 (Cat # L019V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5E11.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXD8 Antibody (5E11.) Summary

Immunogen
HOXD8 (NP_062458 126 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR
Specificity
HOXD8 - homeobox D8 (5E11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXD8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXD8 Antibody (5E11.)

  • homeo box 4E
  • homeo box D8
  • homeobox D8
  • homeobox protein 5.4
  • Homeobox protein Hox-4E
  • Homeobox protein Hox-5.4
  • homeobox protein Hox-D8
  • HOX4
  • HOX4EHox-4.5
  • HOX5.4

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55738
Species: Hu
Applications: ICC/IF
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
H00003204-M01
Species: Hu
Applications: WB, ELISA
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56537
Species: Hu
Applications: ICC/IF
NBP2-56195
Species: Hu
Applications: WB, ICC/IF
NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56557
Species: Hu
Applications: ICC/IF
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52149
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
AF5014
Species: Hu
Applications: WB, ICC
H00003228-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for HOXD8 Antibody (H00003234-M03) (0)

There are no publications for HOXD8 Antibody (H00003234-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXD8 Antibody (H00003234-M03) (0)

There are no reviews for HOXD8 Antibody (H00003234-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXD8 Antibody (H00003234-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXD8 Products

Bioinformatics Tool for HOXD8 Antibody (H00003234-M03)

Discover related pathways, diseases and genes to HOXD8 Antibody (H00003234-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXD8 Antibody (H00003234-M03)

Discover more about diseases related to HOXD8 Antibody (H00003234-M03).
 

Pathways for HOXD8 Antibody (H00003234-M03)

View related products by pathway.

PTMs for HOXD8 Antibody (H00003234-M03)

Learn more about PTMs related to HOXD8 Antibody (H00003234-M03).

Blogs on HOXD8

There are no specific blogs for HOXD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXD8 Antibody (5E11.) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXD8
Entrez
Uniprot