HOXD11 Antibody (6E10.)

Images

 

Product Details

Summary
Product Discontinued
View other related HOXD11 Primary Antibodies

Order Details


    • Catalog Number
      H00003237-M09
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HOXD11 Antibody (6E10.) Summary

Immunogen
HOXD11 (NP_067015, 1 a.a. - 76 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLERAKWPYR
Specificity
HOXD11 - homeobox D11
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXD11
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXD11 Antibody (6E10.)

  • homeo box D11
  • homeobox D11
  • Homeobox protein Hox-4F
  • homeobox protein Hox-D11
  • HOX4
  • Hox-4.6, mouse, homolog of
  • HOX4Fhomeo box 4F

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The product of the mouse Hoxd11 gene plays a role in forelimb morphogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52149
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-80228
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
NBP2-32462
Species: Hu
Applications: IHC, IHC-P
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-55738
Species: Hu
Applications: ICC/IF
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
NBP2-56195
Species: Hu
Applications: WB, ICC/IF
NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
355-BM/CF
Species: Hu, Mu, Rt
NBP2-47428
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003237-M09
Species: Hu
Applications: WB, ELISA

Publications for HOXD11 Antibody (H00003237-M09) (0)

There are no publications for HOXD11 Antibody (H00003237-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXD11 Antibody (H00003237-M09) (0)

There are no reviews for HOXD11 Antibody (H00003237-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXD11 Antibody (H00003237-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXD11 Products

Bioinformatics Tool for HOXD11 Antibody (H00003237-M09)

Discover related pathways, diseases and genes to HOXD11 Antibody (H00003237-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXD11 Antibody (H00003237-M09)

Discover more about diseases related to HOXD11 Antibody (H00003237-M09).
 

Pathways for HOXD11 Antibody (H00003237-M09)

View related products by pathway.

PTMs for HOXD11 Antibody (H00003237-M09)

Learn more about PTMs related to HOXD11 Antibody (H00003237-M09).

Blogs on HOXD11

There are no specific blogs for HOXD11, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXD11 Antibody (6E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXD11
Entrez
OMIM
Uniprot