HOXC4 Antibody (2D6) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related HOXC4 Primary Antibodies

Order Details


    • Catalog Number
      H00003221-M02PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HOXC4 Antibody (2D6) [PE] Summary

Immunogen
HOXC4 (NP_705897 160 a.a. - 264 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL
Specificity
HOXC4 - homeobox C4 (2D6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXC4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXC4 Antibody (2D6) [PE]

  • homeo box 3E
  • homeo box C4
  • homeobox C4
  • Homeobox protein CP19
  • Homeobox protein Hox-3E
  • homeobox protein Hox-C4
  • HOX3
  • HOX3Ecp19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-57662
Species: Hu
Applications: ICC/IF
NBL1-11664
Species: Hu
NBP2-58808
Species: Hu
Applications: WB, ICC/IF

Publications for HOXC4 Antibody (H00003221-M02PE) (0)

There are no publications for HOXC4 Antibody (H00003221-M02PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC4 Antibody (H00003221-M02PE) (0)

There are no reviews for HOXC4 Antibody (H00003221-M02PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXC4 Antibody (H00003221-M02PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXC4 Products

Bioinformatics Tool for HOXC4 Antibody (H00003221-M02PE)

Discover related pathways, diseases and genes to HOXC4 Antibody (H00003221-M02PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC4 Antibody (H00003221-M02PE)

Discover more about diseases related to HOXC4 Antibody (H00003221-M02PE).
 

Pathways for HOXC4 Antibody (H00003221-M02PE)

View related products by pathway.

PTMs for HOXC4 Antibody (H00003221-M02PE)

Learn more about PTMs related to HOXC4 Antibody (H00003221-M02PE).

Blogs on HOXC4

There are no specific blogs for HOXC4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC4 Antibody (2D6) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC4