HOXC10 Antibody (3F2) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related HOXC10 Primary Antibodies

Order Details


    • Catalog Number
      H00003226-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HOXC10 Antibody (3F2) [DyLight 488] Summary

Immunogen
HOXC10 (AAH01293 158 a.a. - 257 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAEN
Specificity
HOXC10 - homeobox C10
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXC10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXC10 Antibody (3F2) [DyLight 488]

  • homeo box C10
  • homeobox C10
  • Homeobox protein Hox-3I
  • homeobox protein Hox-C10
  • homeoprotein C10
  • HOX3I
  • MGC5259

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47428
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBL1-11664
Species: Hu
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
NBP2-56557
Species: Hu
Applications: ICC/IF
NBP1-88644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2492
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58195
Species: Hu
Applications: ICC/IF
NBP2-43834
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-248
Species: Hu
Applications: WB, IP
AF3025
Species: Hu
Applications: WB, ICC
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBL1-11673
Species: Hu
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-00499
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
NBP1-89123
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003226-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HOXC10 Antibody (H00003226-M01G) (0)

There are no publications for HOXC10 Antibody (H00003226-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC10 Antibody (H00003226-M01G) (0)

There are no reviews for HOXC10 Antibody (H00003226-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXC10 Antibody (H00003226-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXC10 Products

Bioinformatics Tool for HOXC10 Antibody (H00003226-M01G)

Discover related pathways, diseases and genes to HOXC10 Antibody (H00003226-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC10 Antibody (H00003226-M01G)

Discover more about diseases related to HOXC10 Antibody (H00003226-M01G).
 

Pathways for HOXC10 Antibody (H00003226-M01G)

View related products by pathway.

PTMs for HOXC10 Antibody (H00003226-M01G)

Learn more about PTMs related to HOXC10 Antibody (H00003226-M01G).
 

Research Areas for HOXC10 Antibody (H00003226-M01G)

Find related products by research area.

Blogs on HOXC10

There are no specific blogs for HOXC10, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC10 Antibody (3F2) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC10