HOXB1 Antibody (1E2.)



Product Details

Product Discontinued
View other related HOXB1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

HOXB1 Antibody (1E2.) Summary

HOXB1 (NP_002135, 1 a.a. - 74 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGV
HOXB1 - homeobox B1
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXB1 Antibody (1E2.)

  • homeo box 2I
  • homeo box B1
  • homeobox B1
  • Homeobox protein Hox-2I
  • homeobox protein Hox-B1
  • HOX2
  • Hox-2.9
  • HOX2I
  • HOX2IMGC116844
  • HOXB1
  • MGC116843
  • MGC116845


This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC
Species: Hu
Applications: Flow, IHC, IHC-Fr
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Ha
Applications: Flow, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
Species: Hu
Applications: WB, ELISA

Publications for HOXB1 Antibody (H00003211-M03) (0)

There are no publications for HOXB1 Antibody (H00003211-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB1 Antibody (H00003211-M03) (0)

There are no reviews for HOXB1 Antibody (H00003211-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXB1 Antibody (H00003211-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HOXB1 Products

Bioinformatics Tool for HOXB1 Antibody (H00003211-M03)

Discover related pathways, diseases and genes to HOXB1 Antibody (H00003211-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB1 Antibody (H00003211-M03)

Discover more about diseases related to HOXB1 Antibody (H00003211-M03).

Pathways for HOXB1 Antibody (H00003211-M03)

View related products by pathway.

PTMs for HOXB1 Antibody (H00003211-M03)

Learn more about PTMs related to HOXB1 Antibody (H00003211-M03).

Blogs on HOXB1

There are no specific blogs for HOXB1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HOXB1 Antibody (1E2.) and receive a gift card or discount.


Gene Symbol HOXB1