HO-1/HMOX1/HSP32 Antibody

Product Discontinued

HO-1/HMOX1/HSP32 Antibody Summary

• Immunogen: Synthetic peptide: MERPQLDSMSQDLSEALKEATKEVHIRAEN, corresponding to amino acids 1-30 of Rat Heme Oxygenase 1.
• Localization: Microsomal
• Marker: Oxidative Stress Marker
• Specificity: Detects HO1.This does not cross react with HO2.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HMOX1
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:100
  • Western Blot 1:1000
• Application Notes: Optimal dilution / concentration should be determined by the end user. By Western blot, this antibody detects a single 32 kDa protein representing HO1 from HeLa cells after stress induction. Immunohistochemical staining of HO1 in Alzheimer's diseased human brain results in staining of the neurofibrillary tangles, senile plaque neurites, and neuropil threads.
• Control:

  HO-1/HMOX1/HSP32 Overexpression Lysate

Reactivity Notes

Cross-reacts with Human, Rat, Cow and Primate.Not yet tested in other species.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: Whole antisera with PBS
• Preservative: 0.05% Sodium Azide
• Purity: Unpurified

Alternate Names for HO-1/HMOX1/HSP32 Antibody

• bK286B10
• EC 1.14.99.3
• heat shock protein, 32-kD
• heme oxygenase (decycling) 1
• HMOX1
• HO
• HO1
• HO-1
• HO-1heme oxygenase 1
• HSP32

Background

Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO1 and a constitutively expressed HO2. HO1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant. HO1 expression is greatly increased in neurofibrillary tangles in Alzheimer’s disease and other neurodegenerative diseases such as progressive supranuclear palsy and subacute sclerosing panencephalitis. Inhibition of HO1 is associated with tissue pathology in atherosclerosis and other inflammatory conditions associated with intravascular thrombosis such as septic shock, hypoxia, and graft rejection.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HMOX1
• Entrez:
  • 3162(Human)
  • 24451(Mouse)
• Uniprot:
  • P06762()