HO-1/HMOX1/HSP32 Antibody

Images

 
Western Blot: HO-1/HMOX1/HSP32 Antibody [H00003162-B01P] - Analysis of HMOX1 expression in human spleen.
Immunocytochemistry/ Immunofluorescence: HO-1/HMOX1/HSP32 Antibody [H00003162-B01P] - Analysis of purified antibody to HMOX1 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: HO-1/HMOX1/HSP32 Antibody [H00003162-B01P] - Analysis of HMOX1 expression in transfected 293T cell line by HMOX1 polyclonal antibody. Lane 1: HMOX1 transfected lysate(31.68 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HO-1/HMOX1/HSP32 Antibody Summary

Immunogen
HMOX1 (ENSP00000216117, 1 a.a. - 288 a.a.) full-length human protein. MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
Marker
Oxidative Stress Marker
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HMOX1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HO-1/HMOX1/HSP32 Antibody

  • bK286B10
  • EC 1.14.99.3
  • heat shock protein, 32-kD
  • heme oxygenase (decycling) 1
  • HMOX1
  • HO
  • HO1
  • HO-1
  • HO-1heme oxygenase 1
  • HSP32

Background

Stressed mammalian cells up-regulate heme oxygenase 1 (HO-1), which catabolizes heme to biliverdin, carbon monoxide, and free iron. Results provide genetic evidence that up-regulation of HO-1 serves as an adaptive mechanism to protect cells from oxidative damage during stress (1). When cells are injured they release their contents, resulting in a local accumulation of free heme proteins and heme. HO-1 plays a crucial role in the inflammatory process during wound healing (2). TNFalpha accelerates inflammatory responses by down-regulating HO-1 expression in human monocytes. TNF antagonists may block this TNF-dependent suppression of HO-1 expression, resulting in an amelioration of inflammation (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01407
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00003162-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for HO-1/HMOX1/HSP32 Antibody (H00003162-B01P) (0)

There are no publications for HO-1/HMOX1/HSP32 Antibody (H00003162-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HO-1/HMOX1/HSP32 Antibody (H00003162-B01P) (0)

There are no reviews for HO-1/HMOX1/HSP32 Antibody (H00003162-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HO-1/HMOX1/HSP32 Antibody (H00003162-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HO-1/HMOX1/HSP32 Products

Bioinformatics Tool for HO-1/HMOX1/HSP32 Antibody (H00003162-B01P)

Discover related pathways, diseases and genes to HO-1/HMOX1/HSP32 Antibody (H00003162-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HO-1/HMOX1/HSP32 Antibody (H00003162-B01P)

Discover more about diseases related to HO-1/HMOX1/HSP32 Antibody (H00003162-B01P).
 

Pathways for HO-1/HMOX1/HSP32 Antibody (H00003162-B01P)

View related products by pathway.

PTMs for HO-1/HMOX1/HSP32 Antibody (H00003162-B01P)

Learn more about PTMs related to HO-1/HMOX1/HSP32 Antibody (H00003162-B01P).
 

Research Areas for HO-1/HMOX1/HSP32 Antibody (H00003162-B01P)

Find related products by research area.

Blogs on HO-1/HMOX1/HSP32

There are no specific blogs for HO-1/HMOX1/HSP32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HO-1/HMOX1/HSP32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMOX1
Entrez
Uniprot